Lab Grown Blue Sapphire and Diamond Flower Bypass Ring

0
Sale price $434 Regular price $499
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Floral Design with Elegant Movement

This lab grown blue sapphire and diamond flower bypass ring is designed for those who appreciate graceful forms and subtle symbolism. The floral motif introduces a natural inspiration, while the bypass design creates a sense of movement and balance.

Its refined appearance makes it suitable for both everyday wear and meaningful occasions.

Flower Motif with Bypass Setting

The flower design brings a soft and detailed visual element, while the bypass band gently curves around the finger, creating an open and flowing structure. This design enhances comfort while offering a distinctive silhouette.

The setting is crafted to hold the stones securely while maintaining a lightweight and wearable feel.

Lab Grown Blue Sapphire with Diamond Accents

The blue sapphire offers a deep and refined color, serving as the focal point of the design. Diamond accents add contrast and light, enhancing the overall composition without overpowering the center.

The sapphire is created without traditional mining, though impact varies by production and energy source.

Versatile for Daily and Occasion Wear

Designed with both style and wearability in mind, this ring transitions easily between everyday use and special occasions. Its smooth structure supports comfort while maintaining visual interest.

It can be worn as a standalone piece or paired with other rings for a layered look.

Product Information
SKU SHP-RINGS0821192904
Width 5 mm
Height 11.5 mm
Weight 2.48 gm (Approximate)
LAB CREATED BLUE SAPPHIRE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.65 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Blue
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAAA
DIAMOND INFORMATION
No.of Stones 18 Pieces
Total Weight 0.23 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-14 Pcs
Round-1.30X1.30 mm-2 Pcs
Round-1.40X1.40 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
flower-jewelry

FAQs About: Lab Grown Blue Sapphire and Diamond Flower Bypass Ring

Is a bypass ring comfortable to wear?
Yes, the curved design of a bypass ring allows it to sit naturally on the finger, offering a comfortable fit.
What does the flower design represent?
Floral motifs often symbolize growth, beauty, and new beginnings, making them meaningful for various occasions.
Is lab grown sapphire suitable for daily wear?
Lab grown sapphire is commonly used in jewelry and can be worn regularly with proper care.
Can this ring be paired with other bands?
Yes, it can be styled with other rings, though its unique shape may influence pairing choices.
Are the diamonds noticeable in this design?
The diamonds add subtle brilliance, complementing the sapphire without dominating the design.
How should this ring be cared for?
Clean gently with a soft cloth, avoid exposure to harsh chemicals, and store it separately to maintain its finish.