Classic Lab Diamond Circle Engagement Ring With Certificate

0
Sale price $956 Regular price $1,099
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Introducing this stunning Lab Created Diamond Engagement Ring, a beautiful combination of classic elegance and modern appeal. Featuring a stunning 7 MM Round Shape Lab Grown Diamond in Prong Setting as the centerpiece, it boasts exceptional clarity, brilliance, and an ethical sparkle. What sets this Solitaire Engagement Ring apart is the unique trio of Lab Diamond stones flanking the center stone, creating a delicate motif that adds a timeless flair. Designed to represent eternal love and growth, this 1 Carat Diamond Ring seamlessly merges tradition with modern creativity. Ideal for proposals or heartfelt promises, this Round Engagement Ring serves as a meaningful reminder of the most cherished moments. Meticulously handcrafted with precision and care, this Solitaire Diamond Engagement Ring is perfect for everyday wear and lasting memories. Whether you are planning a surprise or choosing it to mark your forever story, this Lab Grown Engagement Ring embodies the essence of your love story. Let your forever start with a sparkle that feels just right.

Product Information
SKU SHP-RINGS052410177
Width 4 mm
Height 6.5 mm
Metal Weight 2.00 gm (Approximate)
Center Stone Weight 1.28 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 7 Pieces
Total Weight 1.35 Carat (Approximate)
Dimension(approx) Round-1.40X1.40 mm-6 Pcs
Round-7X7 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More