Certified Tanzanite and Diamond Flower Engagement Ring in Silver

0
Regular price $298
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Say hello to nature’s charm with this dreamy Tanzanite Engagement Ring, a piece that feels like it bloomed straight from a fairytale garden. Whether you are marking a special moment or just want to wear something that makes your heart smile, this Floral Engagement Ring is pure magic. Crafted from White Gold Plated Silver, the Rose Ring showcases a delicate 4 MM round cut Tanzanite of AAA quality set in the center of a rose flower design. Nestled around the rose and along the shank are finely detailed leaf motifs and EF–VS quality Lab Grown Diamonds for just the right amount of sparkle. This Silver Flower Ring is all about the details, from the graceful flower design to the flowing leaf motif, it captures the essence of nature in full bloom. The colors, the textures, the shimmer, it all comes together to create a ring that feels both whimsical and deeply meaningful. Whether you are proposing, celebrating a birthday, or simply indulging in something beautiful, this Tanzanite and Diamond Ring is made for those who appreciate elegance with a touch of natural inspiration. Available in multiple ring sizes and delivered in premium box packaging with a Certificate of Authenticity, it is a treasure you will love today, tomorrow, and forever.

Product Information
SKU RCRI062510011-FBA
Width 6 mm
Height 8 mm
Weight 3.60 gm (Approximate)
Center Stone Weight 0.31 Carat (Approximate)
TANZANITE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.31 Carat (Approximate)
Dimension(approx) Round-4X4 mm-1 Pcs
Color Blue
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
LAB GROWN DIAMOND INFORMATION
No.of Stones 36 Pieces
Total Weight 0.14 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-36 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More