Certified Moissanite Infinity Cross Pendant Necklace

0
Regular price $369
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Meaningful design meets timeless style in this beautifully crafted Moissanite Cross Pendant that brings together faith, love, and a sense of forever. The pendant features a cross symbol, detailed with horizontal and vertical bars lined with sparkling round cut moissanite stones in D-VS1 quality. At the center, an elegant infinity motif is seamlessly woven into the cross, adding a deeper layer of meaning. This thoughtful detail represents endless love and devotion, making the piece feel more personal and emotionally connected. The combination of the cross and infinity symbol creates a design that is both powerful and graceful at the same time. Suspended from a fine chain, this Infinity Cross Necklace is ready to wear and easy to style with both everyday outfits and special occasion looks. It sits comfortably on the neckline, offering a subtle yet meaningful presence. Crafted with care and attention to detail, this Catholic Cross Pendant reflects both quality and thoughtful artistry. It is more than just jewelry - it is a way to express feelings that are sometimes hard to put into words. Perfect as a heartfelt gift, this Religious Pendant Necklace is a beautiful way to share blessings, love, and a lasting connection with someone truly special.

Product Information
SKU SHP-PENDANT072210064
Length 39 mm
Width 20.8 mm
Metal Weight 4.38 gm (Approximate)
Total Stone Weight 0.29 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 29 Pieces
Total Weight 0.29 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-29 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Surfaced-Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-necklaces