Certified Moissanite Butterfly Pendant Necklace For Her

0
Regular price $359
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Moissanite Butterfly Pendant

This butterfly pendant features certified moissanite stones arranged to create a delicate and expressive design. Inspired by the graceful shape of a butterfly, the pendant highlights the gemstone’s brilliance while maintaining a refined and balanced silhouette.

Butterfly jewelry is often chosen for its symbolic meaning and visual elegance. The light and airy form of the butterfly gives the pendant a distinctive character while allowing the gemstones to remain the focal point.

Nature-Inspired Butterfly Design

The butterfly motif has long been associated with transformation, growth, and renewal. Jewelry featuring this symbol is often chosen for its emotional meaning as well as its graceful aesthetic.

The carefully structured wings of the pendant create symmetry within the design, allowing the gemstones to reflect light from multiple angles while maintaining a harmonious appearance.

Certified Moissanite Brilliance

Moissanite is valued for its impressive brilliance and reflective qualities. The gemstone’s structure allows it to capture and disperse light effectively, creating noticeable sparkle in jewelry designs.

Moissanite is created without traditional mining, though the overall environmental impact can vary depending on production processes and energy sources.

A Symbolic and Elegant Pendant

Butterfly pendants combine symbolic meaning with refined design, making them a popular choice for meaningful jewelry gifts. The delicate structure of the butterfly motif offers a graceful balance between decorative artistry and gemstone brilliance.

Whether worn as a personal statement piece or gifted to mark a special moment, a butterfly pendant offers a timeless and expressive jewelry style.

Product Information
SKU SHP-PENDANT072210031
Length 14.6 mm
Width 11.7 mm
Metal Weight 3.00 gm (Approximate)
Total Stone Weight 0.43 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 35 Pieces
Total Weight 0.43 Carat (Approximate)
Dimension(approx) Round-2X2 mm-1 Pcs
Marquise-2X4 mm-2 Pcs
Pear-2.00X3.50 mm-2 Pcs
Round-1X1 mm-30 Pcs
Color White
Cut Brilliant
Shape Round, Marquise, Pear
Setting Type Bezel-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-necklaces

FAQs About: 0.50 CT Certified Moissanite Butterfly Pendant

What does a butterfly pendant symbolize?
Butterfly jewelry is often associated with transformation, renewal, and personal growth. The butterfly motif is widely used as a symbol of change and beauty.
What is moissanite in jewelry?
Moissanite is a gemstone known for its strong brilliance and light reflection. It is created in controlled laboratory conditions and is widely used in modern fine jewelry.
Is moissanite similar to a diamond?
Moissanite and diamond are different gemstones, but both are valued for their brilliance and durability. Moissanite is often chosen for its bright sparkle and distinctive fire.
Can butterfly pendants be worn daily?
Yes. Butterfly pendants are often designed for everyday wear because of their balanced size and lightweight structure, making them easy to pair with different outfits.
Is a butterfly pendant a meaningful jewelry gift?
Butterfly jewelry is frequently chosen as a meaningful gift because the symbol represents growth, transformation, and new beginnings.