Certified Lab Grown Emerald Diamond Flower Engagement Ring with Bypass Shank

0
Sale price $434 Regular price $499
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Celebrate your love with this stunning Flower Engagement Ring, a modern twist on timeless romance. At the heart of this design is a vivid 6 mm Round Shape Lab Created Emerald set in Prong Setting, beautifully placed in a mesmerizing Flower motif that symbolizes blossoming love. The deep green of the AAAA Quality Lab Emerald stands out, catching the light and attention with every move. Surrounding this floral centerpiece is a graceful Bypass Band, studded with sparkling HI-SI Diamond stones that wrap around the finger like a gentle embrace. The unique Bypass design adds a contemporary feel, while the Diamond stones bring just the right amount of shimmer and elegance. Made with ethically sourced Lab Emerald, this Emerald Diamond Engagement Ring is perfect for those who want beauty with a conscience. Whether you are proposing or celebrating a special moment, this Lab Grown Emerald Ring is a bold and meaningful choice. This Bypass Engagement Ring is trendy, elegant and eco-friendly, a perfect match for the modern love story. Wear it as a symbol of your commitment, style and values, all in one breathtaking piece.

Product Information
SKU SHP-RINGS082217403
Width 5 mm
Height 11.5 mm
Metal Weight 3.22 gm (Approximate)
Center Stone Weight 0.80 Carat (Approximate)
LAB CREATED EMERALD INFORMATION
No.of Stones 1 Pieces
Total Weight 0.80 Carat (Approximate)
Dimension(approx) Round-6X6 mm-1 Pcs
Color Green
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAAA
DIAMOND INFORMATION
No.of Stones 18 Pieces
Total Weight 0.23 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-14 Pcs
Round-1.30X1.30 mm-2 Pcs
Round-1.40X1.40 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
lab-created-emerald-engagement-rings