Certified Fire Opal and Diamond Rose Flower Engagement Ring

0
Sale price $175 Regular price $250
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold Plated Silver
Select Your Ring Size (US)
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

As delicate as a petal and as meaningful as a promise, this Fire Opal Engagement Ring brings the beauty of nature into a moment she will never forget. Curated from yellow gold plated silver, this Floral Engagement Ring is centered with a glowing 4 MM round cut Fire Opal, set delicately in prongs. Nestled within a sculpted rose flower motif, the opal radiates a vibrant orange hue that shifts beautifully with every flicker of light. Along the band, leafy detailing brings the design to life, set with EF color VS clarity lab grown diamonds that add a soft sparkle. These subtle diamond accents balance the fire of the center stone, grounding the boldness with grace. Perfect for someone drawn to natural beauty, meaningful symbolism, and romantic designs, this Fire Opal and Diamond Engagement Ring offers something truly different. The rose, a classic emblem of love, paired with the energetic fire opal, creates a piece that speaks to adventurous hearts and deep emotional connections. A beautiful blend of nature inspiration and elegant craftsmanship, this Rose Flower Ring does not follow trends, it tells a story, blooming with every glance.

Product Information
SKU RCRI062510004-FBA
Width 6 mm
Height 8 mm
Weight 3.60 gm (Approximate)
Center Stone Weight 0.22 Carat (Approximate)
FIRE OPAL INFORMATION
No.of Stones 1 Pieces
Total Weight 0.22 Carat (Approximate)
Dimension(approx) Round-4X4 mm-1 Pcs
Color Orange
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
LAB GROWN DIAMOND INFORMATION
No.of Stones 36 Pieces
Total Weight 0.14 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-36 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More