Bezel Set Lab Grown Diamond Knot Promise Ring

0
Sale price $860 Regular price $989
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Meaningful Diamond Knot Promise Ring

This promise ring features a bezel set lab grown diamond integrated into a knot-inspired design. The knot motif represents connection and continuity, making it a symbolic jewelry choice for marking meaningful relationships or personal milestones.

The design places the diamond at the center of the knot structure, allowing the gemstone to stand out while remaining seamlessly connected to the surrounding metalwork.

Symbolism Behind the Knot Design

Knot jewelry has long been associated with ideas of unity, loyalty, and enduring bonds. The interwoven design reflects the concept of two paths joining together, which makes knot rings a popular style for promise rings and meaningful gifts.

The flowing lines of the knot create visual movement in the design while maintaining a balanced and elegant structure.

Bezel Set Lab Grown Diamond

The center diamond is secured in a bezel setting, where metal surrounds the stone’s edges to hold it firmly in place. This setting style offers a smooth and modern appearance while protecting the gemstone within the design.

The diamond is lab grown, meaning it is created without traditional mining. As with all production methods, environmental impact can vary depending on manufacturing processes and energy sources.

A Refined Promise Ring Style

Combining symbolic design with a minimal diamond setting, this ring offers a refined and thoughtful approach to promise jewelry. The knot motif provides visual interest while the diamond adds subtle brilliance.

For those seeking a ring that reflects connection and intention, a diamond knot promise ring presents a meaningful and elegant choice.

Product Information
SKU SHP-RINGS082310214
Width 8 mm
Height 8.6 mm
Metal Weight 2.22 gm (Approximate)
Total Stone Weight 0.46 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 1 Pieces
Total Weight 0.46 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color E-F
Cut Brilliant
Shape Round
Setting Type Bezel Setting
Quality Grade VS
View More

Product Parent Collection Handle
lab-created-diamond-rings

FAQs About: Bezel Set Lab Grown Diamond Knot Promise Ring

What does a knot ring symbolize?
Knot rings traditionally symbolize unity, connection, and enduring relationships. The interwoven design reflects the idea of two paths joining together.
What is a promise ring?
A promise ring is a piece of jewelry given to represent commitment, affection, or a meaningful promise between two people. It is often exchanged before an engagement or as a symbol of a special relationship.
What is a bezel setting in jewelry?
A bezel setting surrounds the gemstone with a thin rim of metal that holds it securely in place. This style provides a smooth appearance while helping protect the edges of the stone.
What is a lab grown diamond?
A lab grown diamond is created in controlled laboratory conditions rather than mined from the earth. It is formed using processes that replicate the conditions under which natural diamonds develop.
Can a promise ring be worn every day?
Yes. Many people choose promise rings designed for everyday wear because of their simple structure and symbolic meaning.