Bezel Set 2 Carat Moissanite Pendant with Bow

0
Regular price $130
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Star Icon

With 18 Inch Chain


Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Adorn your neckline with this Moissanite Pendant Necklace, crafted with 14K White Gold Plated Silver. The pendant features an 8 MM Round Shape Moissanite securely placed in Bezel Setting and topped with a bow motif studded with smaller Moissanite. This Round Pendant beholds the classic shine of D-VS1 Quality Moissanite that is perfect to complete the look for the special day. This Chain and Pendant can be presented to your beloved on a special occasion, such as an anniversary or birthday.

Product Information
SKU RCPE082410087-FBA
Weight 3.81 gm (Approximate)
Center Stone Weight 2.10 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 18 Pieces
Total Weight 2.13 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-17 Pcs
Round-8X8 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Bezel-Setting
Quality Grade D-VS1
View More