8 Carat Black Tahitian Pearl Solitaire Pendant with Leaf Motif

0
Regular price $439
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Highlight the charm of your neckline with this gorgeous Tahitian Pearl Necklace, a classy pick for any woman looking to make a statement. With a keen eye for detail, this pendant features a 10 MM Round Shape Tahitian Pearl set in a Bead Setting as a Solitaire, complemented by a leaf design at the top. Hanging from a chain, this Leaf Necklace symbolizes purity and elegance, making it an ideal accessory for nature enthusiasts. Simple yet sophisticated, this Black Pearl Necklace boasts a deep and rich luster, creating a beautiful piece of jewelry for someone special. The AAA Quality Tahitian Pearl carries a mysterious vibe, representing hope. Its unique design offers a striking contrast that radiates sophistication. The single pearl, celebrated for its rarity and allure, takes the spotlight, turning this Solitaire Necklace into a symbol of purity and grace. The simple style lets the pearls natural beauty shine as it dangles from a chain, making it a perfect option for those who value subtle luxury. As a beloved and timeless jewelry piece, its style, combined with nature-inspired elegance, makes it a fantastic gift for someone dear to you.

Product Information
SKU SHP-PENDANT0821353066
Length 15 mm
Width 10 mm
Metal Weight 3.20 gm (Approximate)
Total Stone Weight 8.00 Carat (Approximate)
TAHITIAN PEARL INFORMATION
No.of Stones 1 Pieces
Total Weight 8.00 Carat (Approximate)
Dimension(approx) Round-10X10 mm-1 Pcs
Color Black
Cut Brilliant
Shape Round
Setting Type Bead-Set
Quality Grade AAA
View More

Product Parent Collection Handle
tahitian-pearl-necklaces