4.4 Carat Round Moissanite Flower Engagement Ring With Enhancer

0
Regular price $499
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Statement Floral Ring with Layered Elegance

The 10mm Round Moissanite Flower Engagement Ring with Enhancer is crafted for those who prefer a bold yet refined expression of style. The floral-inspired silhouette creates a soft, organic feel, while the enhancer adds dimension and presence.

Designed as a coordinated set, it offers a complete look that balances statement design with everyday versatility.

Floral Motif with Enhancer Design

The central round moissanite is arranged within a flower-inspired setting, where surrounding elements create petal-like symmetry. This design softens the overall structure while maintaining a defined focal point.

The enhancer complements the main ring by framing it, adding depth and enhancing the layered appearance. Together, they create a cohesive design that feels intentional rather than separate pieces.

Moissanite for Brilliance and Wearability

Moissanite is chosen for its strong brilliance and visual fire, offering a bright and eye-catching appearance. It is suitable for regular wear and maintains its sparkle over time.

It is created without traditional mining, though its environmental impact varies by production and energy source.

High-Level Features Buyers Appreciate

The combined ring and enhancer design provides a layered look without the need for additional stacking pieces. This makes it suitable for those who prefer a complete and balanced appearance in a single purchase.

The floral structure paired with a bold center stone creates a distinctive piece that works well for special occasions while remaining wearable on a daily basis.

Product Information
SKU SHP-RINGS0821236505
Width 13.5 mm
Height 8 mm
Weight 5.49 gm (Approximate)
Center Stone Weight 5.47 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 103 Pieces
Total Weight 5.47 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-8 Pcs
Round-0.90X0.90 mm-36 Pcs
Round-1.10X1.10 mm-8 Pcs
Round-1.20X1.20 mm-8 Pcs
Round-1.40X1.40 mm-18 Pcs
Round-1.50X1.50 mm-8 Pcs
Round-10X10 mm-1 Pcs
Round-1X1 mm-16 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Floral-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-rings

FAQs About: 10mm Round Moissanite Flower Engagement Ring with Enhancer

What does an enhancer ring do?
An enhancer ring frames the main ring, adding extra dimension and creating a layered, more complete look.
Is this ring a complete set?
Yes, the design includes both the main engagement ring and a matching enhancer that are intended to be worn together.
Is moissanite suitable for daily wear?
Moissanite is durable and suitable for everyday wear, maintaining its brilliance with regular use.
What makes the flower design unique?
The floral arrangement creates a soft, decorative appearance while keeping the center stone as the focal point.
Can the rings be worn separately?
While designed to complement each other, the rings can also be worn individually for a simpler look.
Who is this ring ideal for?
It is ideal for those who prefer bold center stones combined with decorative, nature-inspired design elements.