2.8 Carat Cushion Cut London Blue Topaz and Diamond Engagement Ring with Wedding Band

0
Regular price $759
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Share your love story with our timeless London Blue Topaz Ring Set, which beautifully combines nature-inspired elegance with classic style. This Blue Topaz Bridal Set is an ideal choice for those who appreciate both bold sophistication and meaningful craftsmanship. The Solitaire Wedding Ring Set features two meticulously designed rings: a traditional engagement ring and a wedding band adorned with a leaf motif. At the heart of the engagement ring lies an 8 MM cushion cut london blue topaz, securely held in a claw setting, while small, shimmering diamond side stones along the band provide a subtle touch of brilliance. The coordinating wedding band adds a romantic essence to the ensemble. Crafted with intricate leaf branch designs, each band is embellished with round cut diamond stones, forming a delicate pattern that encircles the finger. Both rings prioritize comfort, ensuring a smooth and secure fit for everyday wear. Whether worn together or separately, they create a stunning expression of love and unity. Ideal for engagements, anniversaries, or vow renewals, this Engagement Ring with Wedding Band Set serves as a meaningful way to commemorate a significant occasion. Presented in an elegant jewelry box, it is ready to be gifted or cherished as a lasting symbol of your devotion.

Product Information
SKU SHP-RINGS032227476
Metal Weight 3.20 gm (Approximate)
Center Stone Weight 2.84 Carat (Approximate)
LONDON BLUE TOPAZ INFORMATION
No.of Stones 1 Pieces
Total Weight 2.84 Carat (Approximate)
Dimension(approx) Cushion-8X8 mm-1 Pcs
Color Blue
Cut Brilliant
Shape Cushion
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 31 Pieces
Total Weight 0.37 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-21 Pcs
Round-1.30X1.30 mm-10 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
london-blue-topaz-women-wedding-bands