1 Carat Sky Blue Topaz Heart Pendant Necklace with Diamond

0
Regular price $170
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold Plated Silver
Star Icon

With 18 Inch Chain


Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Transform every heartbeat into a stunning moment with this Sky Blue Topaz Necklace, a shimmering gem that says more than words ever could. At the center of this delicate pendant lies a beautifully faceted 6 MM heart shaped Sky Blue Topaz, set securely in double prong setting that enhances its brilliance and allows light to dance across the stone. The Heart Shaped Necklace is gracefully suspended from a cable chain by a decorative bail adorned with sparkling lab grown diamonds. Crafted in sterling silver and finished in high-polish yellow gold plating, this piece blends clean, minimal design with timeless sentiment. The heart motif, universally known as a symbol of love, makes this Blue Topaz and Diamond Necklace a thoughtful gift for anniversaries, birthdays, or simply as a reminder of someone special. Whether worn solo or layered, this Sky Blue Topaz Heart Necklace brings a soft pop of color and a romantic accent to any outfit. It arrives beautifully packaged in a signature jewelry box, making it ready to gift or keep close to your own heart.

Product Information
SKU RCPE062510089-FBA
Length 11 mm
Width 5 mm
Weight 3.20 gm (Approximate)
Center Stone Weight 0.90 Carat (Approximate)
SKY BLUE TOPAZ INFORMATION
No.of Stones 1 Pieces
Total Weight 0.90 Carat (Approximate)
Dimension(approx) Heart-6X6 mm-1 Pcs
Color Blue
Cut Brilliant
Shape Heart
Setting Type 3-Prong-Setting
Quality Grade AAA
LAB GROWN DIAMOND INFORMATION
No.of Stones 5 Pieces
Total Weight 0.03 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-1 Pcs
Round-0.90X0.90 mm-1 Pcs
Round-1.10X1.10 mm-1 Pcs
Round-1.20X1.20 mm-2 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type 3-Prong-Setting
Quality Grade EF-VS
View More