Tahitian Pearl and Diamond XO Pendant Necklace for Women

0
Sale price $578 Regular price $649
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Give love a distinctive signature with this Tahitian Pearl and Diamond XO Necklace. A round black Tahitian pearl anchors the romantic XO-inspired design, while natural diamond accents add flashes of light around its dark, lustrous center. Designed for anniversaries, birthdays, romantic gifting, and meaningful milestones, this black pearl necklace balances expressive symbolism with a clean, wearable profile.

8.09 Carat Tahitian Pearl XO Necklace with Natural Diamonds

The necklace centers on one approximately 8.09 carat Tahitian pearl measuring about 8 x 8 mm. The round black pearl is graded AAA quality and secured in a bead setting. Six round natural diamonds add approximately 0.21 carat of brilliance, with HI color, SI quality, brilliant cuts, and bead settings. The pendant measures approximately 15.6 mm long, 10.5 mm wide, and 8 mm high, and comes with an 18-inch chain. Metal choices include 92.5 sterling silver and 10K, 14K, or 18K white and yellow gold.

What Makes This Tahitian Pearl and Diamond Necklace Special

  • One round black Tahitian pearl weighing approximately 8.09 carats.
  • Approximately 8 x 8 mm pearl with AAA quality grade.
  • Six round natural diamonds totaling approximately 0.21 carat.
  • HI-SI brilliant-cut diamonds add contrasting white sparkle.
  • Bead-set pearl and diamond arrangement within a romantic XO design.
  • Compact pendant profile measuring approximately 15.6 x 10.5 mm.
  • Supplied with an 18-inch chain.
  • Available in 92.5 sterling silver and selected yellow rose or white gold options in 10K, 14K, and 18K

The combination of a dark Tahitian pearl, bright diamonds, and XO styling creates a necklace with both visual contrast and romantic character.

Meaning Behind the Tahitian Pearl XO Necklace

The XO motif gives this necklace a clear connection to love and affection, making it especially relevant for a partner, anniversary, birthday, or romantic milestone. Rather than surrounding the pearl with heavy ornamentation, the minimal design allows the black Tahitian pearl to remain the focal point while the diamonds add measured sparkle. This balance makes the necklace meaningful without feeling overly formal or elaborate.

Tahitian Pearl Necklace Authenticity & Craftsmanship

Rosec Jewels crafts its pearl jewelry with attention to stone placement, setting security, and refined finishing. A Certificate of Authenticity is offered with Rosec Jewels jewelry for added purchase confidence, and pieces go through stone inspection, setting security review, and finishing inspection before dispatch. Care guidance also supports proper maintenance of the Tahitian pearl, diamonds, and precious-metal setting.

Styling a Black Tahitian Pearl and Diamond XO Necklace

The 8 mm black pearl creates a strong central contrast against the bright diamonds and precious-metal XO design. Wear the necklace alone as a romantic statement or pair it with small pearl or diamond earrings for a coordinated look. The choice of sterling silver or white gold creates a cooler contrast around the black pearl, while yellow gold adds a warmer frame. Its 18-inch chain makes it suited to everyday necklines as well as dinners, celebrations, anniversaries, and special-event gifting.

Product Information
SKU SHP-PENDANT122110480
Length 15.6 mm
Width 10.5 mm
Height 8 mm
Metal Weight 4.10 gm (Approximate)
Total Stone Weight 7.71 Carat (Approximate)
TAHITIAN PEARL INFORMATION
No.of Stones 1 Pieces
Total Weight 7.50 Carat (Approximate)
Dimension(approx) Round-8X8 mm-1 Pcs
Color Black
Cut Brilliant
Shape Round
Setting Type Bead-Set
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 6 Pieces
Total Weight 0.21 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-1 Pcs
Round-1.80X1.80 mm-1 Pcs
Round-1X1 mm-1 Pcs
Round-2X2 mm-3 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Bead-Set
Quality Grade SI
View More

Product Parent Collection Handle
tahitian-pearl-necklaces

FAQs About: Tahitian Pearl and Diamond XO Necklace

What size and quality is the Tahitian pearl in this XO necklace?

The necklace features one round black Tahitian pearl measuring approximately 8 x 8 mm and weighing about 8.09 carats. The pearl carries an AAA quality grade and is secured in a bead setting. 

How many diamonds are in the Tahitian Pearl XO Necklace?

The necklace includes six round natural diamonds with an approximate combined weight of 0.21 carat. They are brilliant cut, graded HI color and SI quality, and secured in bead settings.

What does the XO design of this pearl necklace represent?

The XO design gives the necklace a romantic identity centered on love and affection. Combined with the Tahitian pearl and diamonds, it makes a meaningful jewelry gift for anniversaries, birthdays, romantic celebrations, and relationship milestones.

What metal options are available for this Tahitian pearl necklace?

The necklace is available in 92.5 sterling silver, 10K white or yellow gold, 14K white or yellow gold, and 18K white or yellow gold.

Does the Tahitian Pearl and Diamond XO Necklace include a chain?

Yes. The necklace is supplied with an 18-inch chain, creating a complete ready-to-wear design.

Does this Tahitian pearl necklace come with a Certificate of Authenticity?

Yes. Rosec Jewels offers a Certificate of Authenticity with its jewelry for added product confidence. Pieces also go through stone inspection, setting security review, and finishing inspection before dispatch.

How should I care for a Tahitian pearl and diamond necklace?

Wipe the Tahitian pearl gently with a soft, clean cloth after wearing it and store the necklace separately to reduce scratching. Keep pearl jewelry away from perfumes, hairspray, harsh chemicals, and abrasive cleaners, and avoid prolonged soaking. Check the setting and chain periodically to help maintain secure wear.