Sterling Silver Cubic Zirconia Infinity Necklace with Heart

0
Sale price $76 Regular price $109
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Star Icon

With 18 Inch Chain


Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Symbolizing endless love and heartfelt connection, this Infinity Necklace is the perfect piece to express what words can not. The elegant Infinity loop is adorned with sparkling Zircon stones, each one adding a brilliant touch that catches the eye. Resting gracefully over the loop is a sweet Heart motif, creating a beautiful blend of meaning and style in one timeless design. The silver chain offers a comfortable fit, making it ideal for everyday wear or for adding a romantic touch to special occasions. Whether you are planning a Valentine’s Day surprise, celebrating an anniversary or simply treating someone you adore, this Infinity Heart Necklace delivers a message of devotion in the most graceful way. Delivered in an elegant jewelry box, this Cubic Zirconia Necklace arrives ready to gift. With its sentimental design and radiant sparkle, this CZ Diamond Necklace is a reminder of love that lasts and connections that remain unbreakable

Product Information
SKU RCPE122410060-FBA
Metal Weight 4.03 gm (Approximate)
Total Stone Weight 0.27 Carat (Approximate)
SIMULATED DIAMOND INFORMATION
No.of Stones 10 Pieces
Total Weight 0.27 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-10 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade AAAA
View More