Rose Flower Engagement Ring with London Blue Topaz and Diamond

0
Sale price $613 Regular price $689
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Proposal Inspired by Nature

The Rose Flower Engagement Ring with London Blue Topaz and Diamond blends floral symbolism with refined gemstone design. Inspired by the shape of a blooming rose, this ring centers on London Blue Topaz, complemented by diamond accents that enhance its brilliance. It is designed for those who want an engagement ring that feels distinctive yet timeless.

Rose-Inspired Design & Setting

The floral motif gives the ring a sculptural quality, with petal-like detailing that frames the center stone. This thoughtful structure allows the London Blue Topaz to remain the focal point while the surrounding diamond accents add contrast and light reflection. The design balances romantic symbolism with everyday elegance, making it visually expressive without appearing overstated.

Stone Character & Wear Considerations

London Blue Topaz is appreciated for its deep, rich blue tone. As with all natural gemstones, individual stones may display slight variations in color and internal characteristics. Diamond accents contribute additional sparkle and definition to the overall design. With appropriate care and mindful wear, this ring can be enjoyed regularly. Removing jewelry during high-impact activities helps maintain its finish and structure.

High-Level Features Buyers Consider

  • London Blue Topaz center: deep blue hue with refined presence.
  • Diamond accents: added brilliance and visual contrast.
  • Rose flower motif: symbolic design inspired by nature.
  • Metal options available: choose your preferred metal directly on the product page.
Product Information
SKU SHP-RINGS092310016
Metal Weight 3.80 gm (Approximate)
Center Stone Weight 1.35 Carat (Approximate)
LONDON BLUE TOPAZ INFORMATION
No.of Stones 1 Pieces
Total Weight 1.35 Carat (Approximate)
Dimension(approx) Round-7X7 mm-1 Pcs
Color Blue
Cut Brilliant
Shape Round
Setting Type Claw-Set
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 16 Pieces
Total Weight 0.40 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-16 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Claw-Set
Quality Grade SI
View More

Product Parent Collection Handle
london-blue-topaz-rings
Is the center stone a natural London Blue Topaz?
The ring features London Blue Topaz as the center stone. Natural gemstones may show individual variations in tone and internal characteristics.
What makes this ring different from a classic engagement ring?
The rose-inspired floral design offers a more symbolic and nature-influenced aesthetic compared to traditional solitaire styles, while still maintaining a refined structure.
Are the diamonds natural?
The ring includes diamond accents as listed in the product details table. Refer to the specifications section for exact information about the diamonds used.
Is this ring suitable for daily wear?
With proper care, the ring can be worn regularly. Removing it during strenuous or high-impact activities helps preserve the setting and surface finish.
How should I clean and care for this ring?
Clean gently with mild soap, warm water, and a soft brush or cloth. Avoid harsh chemicals and store separately to reduce surface scratches.