Real Half Carat Black Opal Star Pendant Necklace for Women

0
Regular price $359
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Elevate your style with this dazzling Star Pendant Necklace, a piece that feels like wearing a little piece of the night sky. At its center shines a 5 mm Round Shape Black Opal set in Prong Setting, its deep, shifting colors catching the light with every turn and adding a magical, iridescent glow. The AAA Quality Black Opal is perfectly set within a Star Shaped motif, symbolizing brilliance and a touch of celestial wonder. Designed for women who love to mix elegance with a hint of playful charm, this Black Opal Pendant Necklace is versatile enough to wear with casual outfits or to make a statement at special occasions. This October Birthstone Necklace comes in a sleek jewelry box, making it ready to gift or keep as a treasured addition to your collection. The combination of the Black Opal and the star design creates a captivating contrast that draws the eye, making it both unique and timeless. Chic and effortlessly stylish, this Opal Necklace for Women layers beautifully with other pieces or stands alone as a show-stopping accent.

Product Information
SKU SHP-PENDANT032215676
Length 18.7 mm
Width 12.6 mm
Metal Weight 3.60 gm (Approximate)
Total Stone Weight 0.45 Carat (Approximate)
BLACK OPAL INFORMATION
No.of Stones 1 Pieces
Total Weight 0.45 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Black
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
View More

Product Parent Collection Handle
black-opal-necklace