Real Emerald Leaf Stud Earrings with Moissanite

0
Sale price $336 Regular price $369
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Inspired by the graceful symmetry of nature, these elegant Emerald Leaf Earrings are a celebration of organic beauty and refined craftsmanship. The Nature Inspired Earrings begin with a distinctive geometric frame studded with round cut diamonds. Attached beneath this diamond motif are vivid marquise cut emeralds that mimic the natural form of a leaf, and secured in prong setting to enhance the design from every angle. Completing the design are secure screw back closures, ensuring both comfort and confidence in wear. These Emerald Stud Earrings beautifully combine the timeless elegance of AAA Quality emeralds with the ethical brilliance of EF-VS Quality lab grown diamonds, offering a nature-inspired statement that is both luxurious and conscious. Ideal for nature lovers and those who appreciate symbolic design, these Emerald and Diamond Earrings are more than jewelry - they are a graceful tribute to growth, beauty, and renewal.

Product Information
SKU SHP-EARRINGS052310042
Metal Weight 1.48 gm (Approximate)
Total Stone Weight 0.37 Carat (Approximate)
EMERALD INFORMATION
No.of Stones 10 Pieces
Total Weight 0.34 Carat (Approximate)
Dimension(approx) Marquise-1.50X3.00 mm-10 Pcs
Color Green
Cut Brilliant
Shape Marquise
Setting Type Prong-Setting
Quality Grade AAA
LAB GROWN DIAMOND INFORMATION
No.of Stones 6 Pieces
Total Weight 0.03 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-4 Pcs
Round-1X1 mm-2 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More