Real Emerald and Diamond Heart Promise Ring with Twisted Shank

0
Regular price $519
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

This Real Emerald and Diamond Heart Promise Ring is designed to symbolize commitment, affection, and intention. The heart-shaped center highlights the emotional significance of the piece, while the emerald brings vibrant green depth that feels both personal and distinctive. It is an ideal choice for a promise ring, romantic milestone, or heartfelt gift that carries lasting meaning.

Twisted Shank with Thoughtful Detail

The twisted shank design adds dimension and visual movement to the ring, creating a balanced contrast against the defined heart silhouette. Diamond accents enhance the structure with subtle brilliance, offering light reflection without overpowering the center stone. This interplay of shape and texture gives the ring a refined designer appeal while maintaining everyday wearability.

The Appeal of Real Emerald

Emerald is valued for its rich green hue and timeless association with growth and renewal. As a natural gemstone, each emerald displays unique internal characteristics that contribute to its individuality. When set in a protective structure and worn with care, it can be enjoyed regularly as a meaningful piece of fine jewelry.

Designed for Romantic Gifting

The heart motif makes this ring especially suited for promise exchanges and relationship milestones. Its elegant proportions allow it to be worn alone as a statement of commitment or paired with complementary bands for a layered look. The overall design focuses on symbolism, balance, and refined craftsmanship rather than trend-driven styling.

Product Information
SKU SHP-RINGS0821221469
Width 2.9 mm
Height 6.4 mm
Metal Weight 2.13 gm (Approximate)
Center Stone Weight 0.56 Carat (Approximate)
EMERALD INFORMATION
No.of Stones 1 Pieces
Total Weight 0.56 Carat (Approximate)
Dimension(approx) Heart-5X5 mm-1 Pcs
Color Green
Cut Brilliant
Shape Heart
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 1 Pieces
Total Weight 0.05 Carat (Approximate)
Dimension(approx) Round-2X2 mm-1 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
emerald-rings

FAQs About: Real Emerald and Diamond Heart Promise Ring with Twisted Shank

Is this ring suitable as a promise ring?
Yes. The heart-shaped design and emerald center make it a meaningful choice for expressing commitment, affection, or a romantic promise.
Can emerald be worn daily?
Emerald can be worn regularly with mindful care. It is recommended to remove the ring during heavy impact activities to help maintain the gemstone’s condition.
What does the twisted shank design represent?
A twisted shank often symbolizes two paths coming together, adding deeper meaning to the promise ring while enhancing its visual dimension.
Are the diamonds meant to highlight the emerald?
Yes. The diamond accents provide subtle brilliance that frames the emerald heart, helping it remain the focal point of the design.
How should I care for this emerald and diamond ring?
Clean gently with mild soap, lukewarm water, and a soft cloth. Avoid harsh chemicals and store the ring separately to help preserve the gemstone and metal finish.