Pear Shape Diamond Crawler Earring for Cartilage Piercing

0
Regular price $969
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

This crawler earring features pear-shaped diamonds arranged in a design that follows the natural curve of the ear. The elongated silhouette creates a graceful climbing effect that adds visual movement while maintaining a refined profile.

The arrangement of stones forms a balanced composition that highlights both the distinctive shape of the diamonds and the modern crawler style.

Crawler Earring Design

Crawler earrings are designed to extend upward along the ear, creating a climbing visual effect. Unlike traditional studs, this style follows the contour of the ear and introduces a more contemporary jewelry aesthetic.

The structure allows multiple stones to appear aligned along the ear while remaining compact and visually balanced.

Pear Shape Diamond Detail

Pear-shaped diamonds combine the brilliance of a round cut with an elongated tapered point. This distinctive shape adds elegance and visual direction to jewelry designs.

When arranged in sequence, pear shapes create a flowing pattern that enhances the overall form of the earring.

Cartilage Piercing Jewelry

Cartilage earrings are created for piercings located along the upper portion of the ear. Designs for this area often emphasize compact proportions and distinctive shapes that complement ear styling.

Crawler earrings are frequently chosen for cartilage placements because their structure follows the natural curve of the ear.

Contemporary Ear Styling

Modern ear styling often combines multiple earrings in different placements to create layered visual detail. Crawler earrings add dimension and movement within these curated arrangements.

The combination of pear-shaped diamonds and a climbing structure results in a distinctive earring design that blends elegance with contemporary style.

Product Information
SKU SHP-BODYJ052310040
Metal Weight 0.50 gm (Approximate)
Total Stone Weight 0.55 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 5 Pieces
Total Weight 0.55 Carat (Approximate)
Dimension(approx) Pear-2X3 mm-5 Pcs
Color HI
Cut Brilliant
Shape Pear
Setting Type Prong-Setting
Quality Grade SI
View More

FAQs About: Pear Shape Diamond Crawler Earring for Cartilage Piercing

What is a crawler earring?
A crawler earring is designed to follow the curve of the ear, creating a climbing effect rather than hanging downward like traditional earrings.
What is a pear-shaped diamond?
A pear-shaped diamond combines a rounded end with a tapered point, forming an elegant teardrop-like silhouette commonly used in jewelry.
What is cartilage piercing jewelry?
Cartilage piercing jewelry is designed for piercings located along the upper ear rather than the earlobe, often featuring compact and decorative styles.
Why are crawler earrings popular?
Crawler earrings are popular because they create a distinctive climbing look that adds dimension and visual interest to ear styling.
How do pear-shaped gemstones affect jewelry design?
Pear-shaped gemstones introduce an elongated silhouette that adds direction and elegance to jewelry compositions.
Are crawler earrings used in layered ear styling?
Crawler earrings are often included in layered ear styling because their elongated design complements other earrings worn along the ear.