Oval Cut Moonstone Half Eternity Wedding Band Ring

0
Sale price $391 Regular price $439
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Softly luminous and filled with quiet sentiment, this oval moonstone half eternity wedding band is designed for love that feels calm, meaningful, and deeply personal. Nine light blue moonstones flow across the upper half of the band, creating a gentle row of shimmer that catches the light with an ethereal glow. Its graceful half eternity silhouette makes it a beautiful choice for weddings, anniversaries, promise moments, or a personal ring that celebrates intuition, connection, and cherished memories.

Oval Cut Moonstone Half Eternity Wedding Band Ring

This moonstone wedding band is crafted with 9 oval moonstones in AAA quality, each measuring approximately 3 x 5 mm. The brilliant cut stones are arranged in a half eternity style and secured with a shared prong setting, giving the ring a refined line of color and glow across the finger. With an approximate total moonstone weight of 2.07 carats, a 2.5 mm width, and multiple sterling silver and gold options, it offers a meaningful balance of beauty, comfort, and everyday wearability.

What Makes This Special

The ring features 9 oval moonstones with an approximate total weight of 2.07 carats. Each stone measures approximately 3 x 5 mm, creating a graceful sequence of light blue gemstones across the visible part of the band.

The moonstones are light blue in color, oval in shape, brilliant cut, and AAA quality grade. They are secured in a shared prong setting, which helps keep the stones neatly aligned while allowing the half eternity design to feel open and delicate.

The ring measures approximately 2.5 mm in width and 5 mm in height, with an approximate weight of 3.44 gm. Metal options include 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold. Ring sizes are available from US 3 to US 13, including quarter-size options.

Why Choose This Design

A half eternity band gives the romance of gemstone sparkle while keeping the underside of the ring smooth and practical for regular wear. The oval moonstones create an elongated look on the finger, while their soft light blue glow gives the design a dreamy, soothing character.

The shared prong setting supports the stones with minimal metal between them, helping the row of moonstones feel continuous and refined. Worn as a wedding band, anniversary ring, or stackable gemstone band, it adds a gentle alternative to traditional diamond sparkle.

Design Meaning

Moonstone is often associated with intuition, emotional balance, new beginnings, and the quiet strength of love. In a half eternity design, the row of oval stones can symbolize shared moments, growing devotion, and the promise of many chapters ahead. Its luminous glow makes the ring especially meaningful for a wedding, anniversary, or personal milestone rooted in tenderness and trust.

Authenticity & Craftsmanship

Each ring is carefully crafted with attention to moonstone selection, oval stone alignment, shared prong setting security, balanced proportions, and refined finishing. Rosec Jewels offers a Certificate of Authenticity with the product, adding confidence to the purchase experience. Before dispatch, every piece goes through stone inspection, setting security review, and finishing inspection to help ensure it is ready for gifting or everyday wear. For lasting care, store the ring separately, avoid harsh chemicals, and wipe it gently with a soft cloth after wear.

Style and Wearability

This moonstone half eternity band brings a soft light blue glow to the hand, making it easy to style alone or stack with bridal rings, plain bands, slim diamond bands, or other gemstone rings. Its 2.5 mm width keeps the look refined, while the oval stone row gives the design enough presence for meaningful occasions. It is well suited for wedding band, anniversary gifting, promise rings, and everyday wear with thoughtful care.

Product Information
SKU SHP-RINGS0821177330
Width 2.5 mm
Height 5 mm
Weight 3.44 gm (Approximate)
Center Stone Weight 2.07 Carat (Approximate)
MOONSTONE INFORMATION
No.of Stones 9 Pieces
Total Weight 2.07 Carat (Approximate)
Dimension(approx) Oval-3X5 mm-9 Pcs
Color light blue
Cut Brilliant
Shape Oval
Setting Type Shared Prong
Quality Grade AAA
View More

Product Parent Collection Handle
moonstone-rings

FAQs About: Oval Cut Moonstone Half Eternity Wedding Band Ring

What makes this moonstone half eternity ring meaningful for a wedding or anniversary?

The half eternity design represents love and commitment continuing through shared moments. The light blue moonstones add a soft emotional meaning, often connected with intuition, balance, new beginnings, and tenderness.

How many moonstones are set in this ring?

The ring includes 9 oval moonstones with an approximate total weight of 2.07 carats. Each moonstone measures approximately 3 x 5 mm.

What color, cut, and quality are listed for the moonstones?

The moonstones are light blue in color, oval in shape, and brilliant cut. They are listed with an AAA quality grade.

What setting style is used for this moonstone band?

The moonstones are secured in a shared prong setting. This setting helps hold the stones in a neat row while allowing the half eternity design to keep an open, delicate look.

Is this a full eternity or half eternity ring?

This is a half eternity ring. The moonstones are arranged across the visible upper portion of the band, offering gemstone sparkle while keeping the underside smoother for comfortable wear.

What metal options are available for this moonstone ring?

This design is available in 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold, allowing buyers to choose the metal tone and purity that best suits their style.

How should I care for this oval moonstone wedding band?

Store the ring separately to help prevent scratches, avoid harsh chemicals, and wipe it gently with a soft cloth after wear. For deeper cleaning, use mild soap, lukewarm water, and a soft brush, then dry the ring carefully before storing.