Nature Inspired Freshwater Pearl and Diamond Crawler Earring

0
Regular price $509
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Make a stunning impression with this Climber Earring, boasting an elegant design that is sure to turn heads. Composed of high quality metal and adorned with a Round Shape Freshwater Pearl at the center with Round and Marquise Cut Lab Grown Diamonds set in Prong Setting to create a flower and butterfly motif, this Cartilage Earring is perfect for adding a touch of glamour to your look. You can also wear this versatile Body Jewelry on your Cartilage, Helix, or upper lobe Piercing. The simple Flat Back Closure ensures a secure fit. Wear this Pearl Helix Earring to impress on any occasion, or gift it to your special someone for a perfect birthday present. Whether worn alone as a statement piece or paired with other earrings for a layered effect, it makes an instant upgrade to any outfit. Crafted with attention to detail, this Crawler Earring combines sparkle, durability, and modern design in one elegant accessory.

Product Information
SKU SHP-BODYJ012210126
Metal Weight 0.70 gm (Approximate)
Total Stone Weight 2.16 Carat (Approximate)
FRESHWATER PEARL INFORMATION
No.of Stones 1 Pieces
Total Weight 2.00 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
LAB GROWN DIAMOND INFORMATION
No.of Stones 10 Pieces
Total Weight 0.16 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-2 Pcs
Round-1.50X1.50 mm-6 Pcs
Marquise-1.50X3.00 mm-2 Pcs
Color White
Cut Brilliant
Shape Round, Marquise
Setting Type Prong-Setting
Quality Grade EF-VS
View More

Product Parent Collection Handle
cartilage-earrings