Natural Ethiopian Opal Floral Pendant Necklace with Diamond

0
Regular price $569
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Ethiopian Opal Floral Pendant Necklace

This pendant necklace features a natural Ethiopian opal at the center of a floral-inspired design accented with diamonds. The composition highlights the distinctive play of color within the opal while the surrounding details create a decorative framework that emphasizes the gemstone.

Opals are recognized for their shifting colors that appear when light interacts with the stone’s internal structure. In this pendant, the opal becomes the focal point, complemented by diamond accents and a carefully structured floral motif.

Floral Inspired Pendant Design

The pendant incorporates a floral-inspired structure that arranges the surrounding metal and diamond accents in a pattern resembling petals. Floral jewelry designs are often used to introduce soft, organic shapes that frame the central gemstone.

This structure creates visual balance within the pendant while allowing the center stone to remain clearly visible and prominent.

Natural Ethiopian Opal Center Stone

Ethiopian opals are valued for their vibrant play-of-color, where flashes of multiple hues appear across the surface of the gemstone. These color variations make each opal visually distinctive.

Because of their dynamic color display, opals are often used in jewelry designs where the gemstone itself becomes the main artistic feature.

Diamond Accent Details

Diamonds are incorporated as accent stones around the central opal to introduce brightness and contrast. Their reflective qualities enhance the surrounding structure of the pendant while complementing the gemstone’s color variations.

The combination of opal color play and diamond accents produces a balanced pendant design that blends gemstone character with decorative craftsmanship.

Product Information
SKU SHP-PENDANT032214548
Metal Weight 3.50 gm (Approximate)
Total Stone Weight 0.77 Carat (Approximate)
ETHIOPIAN OPAL INFORMATION
No.of Stones 1 Pieces
Total Weight 0.51 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Rainbow
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 28 Pieces
Total Weight 0.26 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-4 Pcs
Round-1.10X1.10 mm-4 Pcs
Round-1.20X1.20 mm-8 Pcs
Round-1.30X1.30 mm-8 Pcs
Round-1X1 mm-4 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
opal-necklaces

FAQs About: Natural Ethiopian Opal Floral Pendant Necklace with Diamond

What is Ethiopian opal known for?
Ethiopian opal is known for its play-of-color, where flashes of different colors appear as light moves across the gemstone.
What does a floral jewelry design represent?
Floral jewelry designs use shapes inspired by flowers and natural forms to create decorative and balanced gemstone arrangements.
Why are diamonds used as accent stones?
Diamonds are often used as accent stones because their brilliance enhances the visual appearance of the central gemstone.
What makes opal jewelry distinctive?
Opal jewelry is distinctive because each stone displays unique color patterns that shift under different lighting conditions.
Are gemstone pendant necklaces commonly worn daily?
Many pendant necklaces are designed for everyday wear, offering a balanced jewelry piece that highlights a central gemstone.
Why choose an opal pendant necklace?
Opal pendant necklaces are chosen for their colorful appearance and the way the gemstone’s natural color play becomes the focal point of the jewelry design.