Certified Diamond Lotus Flower Earring with Flat Back

0
Regular price $449
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Symbol of Grace in a Refined Silhouette

The Natural Diamond Lotus Flower Earring with Flat Back blends symbolic design with everyday wearability. Inspired by the lotus motif, this piece represents growth and renewal while maintaining a delicate, modern profile. Designed for those who prefer meaningful jewelry in a subtle scale, it complements curated ear styling without overwhelming the look.

Flat Back Design for Secure Comfort

The flat back structure is selected for a close, low-profile fit against the ear. This construction helps reduce protrusion, making it suitable for cartilage or upper ear piercings where comfort and stability are essential. The design supports balanced placement while maintaining a refined appearance from every angle.

Natural Diamond Craftsmanship

The lotus form is accented with natural diamonds that provide measured brilliance within a compact setting. Natural diamonds are valued for their durability and suitability for regular wear when properly cared for. Specific stone and metal details are outlined clearly in the product tables above for complete transparency.

High-Level Features

  • Lotus flower inspired design with natural diamond accents.
  • Flat back construction for a streamlined profile.
  • Crafted in precious metal options listed in the specification table.
  • Designed for secure placement and everyday styling versatility.
Product Information
SKU SHP-BODYJ052310055
Length 7.3 mm
Width 8.6 mm
Height 2.9 mm
Metal Weight 0.50 gm (Approximate)
Total Stone Weight 0.27 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 10 Pieces
Total Weight 0.27 Carat (Approximate)
Dimension(approx) Round-2.30X2.30 mm-3 Pcs
Round-1.70X1.70 mm-1 Pcs
Round-1X1 mm-6 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

FAQs about: Natural Diamond Lotus Flower Earring with Flat Back

Is this earring sold as a single piece or a pair?
Please refer to the product detail tables above to confirm whether the item is offered as a single earring or as a pair, as this information is specified there.
What type of piercing is this flat back earring suitable for?
The flat back design is commonly chosen for cartilage, helix, or upper ear piercings due to its low-profile structure and secure fit.
Are the diamonds in this earring natural?
Yes, this piece features natural diamonds. Detailed specifications, including stone information, are provided in the product tables above.
Is the flat back comfortable for extended wear?
The flat back construction is designed to sit closer to the ear, which many wearers find more comfortable for daily use compared to traditional protruding backs.
How should I care for a natural diamond flat back earring?
Clean gently using mild soap and warm water with a soft brush, then dry with a lint-free cloth. Store separately to help protect the metal surface and stone setting.