Natural Diamond Hoop Earrings in Infinity Style

0
Regular price $1,479
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K White Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Natural Diamond Infinity Hoop Earrings

These natural diamond infinity hoop earrings are designed for women who appreciate symbolic design expressed through refined jewelry. The infinity motif adds meaning to a classic hoop silhouette, making this piece suitable for both personal wear and thoughtful gifting.

The design is understated yet expressive, created to complement everyday outfits while maintaining a polished and intentional look.

Design & Setting

The infinity-inspired structure integrates seamlessly into the hoop form, creating visual continuity without disrupting balance or proportion. Diamonds are placed to enhance light reflection while maintaining a clean outline.

This setting approach supports comfortable wear and preserves the integrity of the design during regular use.

Stone Value & Wearability

Crafted with natural diamonds, these earrings are suitable for routine wear when handled with appropriate care. The setting prioritizes security while allowing the stones to retain their natural brilliance.

High-Level Features

  • Infinity-style hoop earring design
  • Set with natural diamonds
  • Balanced structure for daily wear
  • Symbolic design with a classic profile
Product Information
SKU SHP-EARRINGS032230513
Length 15.2 mm
Width 4 mm
Height 13 mm
Metal Weight 4.60 gm (Approximate)
Total Stone Weight 0.34 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 20 Pieces
Total Weight 0.34 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-8 Pcs
Round-1.40X1.40 mm-6 Pcs
Round-1.30X1.30 mm-4 Pcs
Round-1.10X1.10 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type French-Pave-Setting
Quality Grade SI
View More

Product Parent Collection Handle
diamond-earrings
Are these earrings suitable for everyday wear?
These earrings can be worn daily depending on lifestyle and proper care.
What does the infinity design represent?
The infinity design is commonly associated with continuity, connection, and lasting meaning.
Are the diamonds natural?
Diamond details are confirmed in the product specification tables.
What metal options are available?
Available metal options are listed in the existing product detail tables.
Are these earrings sold as a pair?
These earrings are sold as a pair unless stated otherwise in the product details.