Natural Diamond Anniversary Band Ring with Certificate

0
Sale price $1,373 Regular price $1,509
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Diamond Anniversary Band Ring

The Natural Diamond Anniversary Band Ring with Certificate presents a refined design created to celebrate important milestones. Featuring a sequence of natural diamonds arranged along the band, this ring offers a balanced composition that highlights the brilliance of each stone while maintaining an elegant profile.

Classic Diamond Band Design

The band design focuses on a continuous line of diamonds set along the ring to create a harmonious flow of light. This arrangement enhances the natural sparkle of the stones while maintaining a clean and structured appearance. The result is a diamond band that feels timeless and versatile.

Natural Diamonds

Natural diamonds are valued for their brilliance and durability, making them a traditional choice for anniversary jewelry. The gemstones reflect light across their facets, creating a bright appearance that complements the refined structure of the band.

A Meaningful Anniversary Ring

Anniversary bands are often chosen to mark special moments such as wedding anniversaries or significant life events. The diamond arrangement and classic structure allow this ring to be worn alongside other jewelry or as a standalone piece that symbolizes lasting commitment.

Product Information
SKU SHP-RINGS022210110
Width 4.5 mm
Height 2 mm
Metal Weight 3.30 gm (Approximate)
Total Stone Weight 0.54 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 9 Pieces
Total Weight 0.54 Carat (Approximate)
Dimension(approx) Baguette-2X4 mm-3 Pcs
Round-1.80X1.80 mm-6 Pcs
Color HI
Cut Brilliant
Shape Baguette, Round
Setting Type Channel Setting
Quality Grade SI
View More

Product Parent Collection Handle
men-ring
What is an anniversary band ring?
An anniversary band ring is a ring traditionally given to celebrate milestones such as wedding anniversaries or meaningful life events.
Why are diamonds commonly used in anniversary rings?
Diamonds are often used in anniversary rings because of their brilliance and durability, which make them suitable for everyday jewelry.
Can a diamond anniversary band be worn every day?
Diamond bands are commonly worn daily due to the durability of diamonds. Proper care can help maintain the ring’s appearance over time.
What does a certified diamond ring mean?
A certified diamond ring includes documentation that verifies the authenticity and characteristics of the diamonds used in the jewelry.
How should a diamond band ring be cleaned?
Clean the ring using warm water, mild soap, and a soft brush or cloth. Rinse gently and dry with a soft cloth to maintain the diamonds’ brilliance.