Natural Black Opal Solitaire Swirl Stud Earrings

0
Regular price $329
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

The stunning Black Opal Stud Earrings beautifully combine movement and elegance, designed to embody the gentle flow of a spiral. They showcase radiant 5 MM round black opal stones, securely held in prong setting. Encircling the opal is a swirl pattern, adding a unique charm to the design. This swirling design imparts a sense of gentle motion to the Dark Opal Stud Earrings. Featuring secure screw-back closures, these Black Opal Earrings ensure comfort and safety for all-day wear. Their sophisticated shape makes them ideal for enhancing any outfit, whether you are dressing up for a special occasion or adding a hint of charm to your daily attire. The spiral motif symbolizes harmony, balance, and beauty, making these Swirl Earrings a meaningful gift for birthdays, anniversaries, or romantic occasions. The deep hues of the black opal combined with the smooth metal create a striking contrast that feels both contemporary and timeless. More than mere accessories, these Spiral Earrings are a graceful representation of movement, light, and enduring elegance.

Product Information
SKU SHP-EARRINGS032210963
Length 5.3 mm
Width 5.3 mm
Height 2.4 mm
Metal Weight 1.67 gm (Approximate)
Total Stone Weight 0.90 Carat (Approximate)
BLACK OPAL INFORMATION
No.of Stones 2 Pieces
Total Weight 0.90 Carat (Approximate)
Dimension(approx) Round-5X5 mm-2 Pcs
Color Black
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
View More

Product Parent Collection Handle
black-opal-earrings