Natural Black Onyx Sunburst Drop Hoop Earrings for Women

0
Sale price $943 Regular price $1,059
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K White Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Bring bold contrast and movement to your jewelry collection with these Natural Black Onyx Sunburst Hoop Drop Earrings. Each earring suspends a round black onyx beneath a hinged hoop, with a sculptural sunburst frame surrounding the gemstone. The deep black center and radiating metal detail create an expressive drop silhouette suited to everyday styling, evening looks, celebrations, and thoughtful gifting.

0.44 Carat Black Onyx Sunburst Hoop Drop Earrings

The pair features two natural black onyx gemstones with an approximate combined weight of 0.44 carat. Each round stone measures about 4 x 4 mm, has a brilliant cut, AAA quality grade, and is secured in a bezel setting. The earrings measure approximately 28 mm in length and 10.3 mm in width. The confirmed design is crafted in 10K white gold with an approximate metal weight of 3.78 grams and finished with hinged hoops for secure wear.

What Makes These Black Onyx Sunburst Earrings Special

  • Two round natural black onyx gemstones totaling approximately 0.44 carat.
  • Each gemstone measures approximately 4 x 4 mm.
  • AAA quality black onyx with brilliant-cut faceting.
  • Bezel settings create clean, defined borders around the dark centers.
  • Radiating sunburst frames add dimension around each gemstone.
  • Drop construction introduces movement beneath the hoops.
  • Hinged hoop closures support secure, convenient wear.
  • Approximately 28 mm long and 10.3 mm wide.
  • Crafted in in 92.5 sterling silver and selected yellow or white gold options in 10K, 14K, and 18K .

Meaning Behind the Black Onyx Sunburst Drop Design

The sunburst motif creates a sense of energy and radiance around the dark onyx center, making the contrast between gemstone and metal a defining part of the design. The circular stone keeps the composition balanced, while the suspended drop adds movement as the earrings are worn. This combination works especially well for someone who prefers expressive gemstone jewelry with a graphic, contemporary profile.

Natural Black Onyx Earring Authenticity & Craftsmanship

Rosec Jewels crafts its gemstone jewelry with attention to stone placement, secure settings, hinged components, and refined finishing. A Certificate of Authenticity is offered with Rosec Jewels jewelry for added purchase confidence. Each piece also goes through stone inspection, setting security review, and finishing inspection before dispatch, with care guidance provided to support responsible long-term wear.

Styling Black Onyx Hoop Drop Earrings

The 28 mm drop gives these earrings noticeable movement without creating an overly long silhouette, while the round black onyx centers provide strong contrast against 10K white gold. Wear them with monochrome outfits for a coordinated look, pair them with other black onyx jewelry, or use them as a defined accent with evening and occasion styling. Their hinged hoops also make them practical for regular wear when handled with appropriate care.

Product Information
SKU SHP-EARRINGS0621107111
Length 28 mm
Width 10.3 mm
Metal Weight 3.78 gm (Approximate)
Total Stone Weight 0.44 Carat (Approximate)
BLACK ONYX INFORMATION
No.of Stones 2 Pieces
Total Weight 0.44 Carat (Approximate)
Dimension(approx) Round-4X4 mm-2 Pcs
Color Black
Cut Brilliant
Shape Round
Setting Type Bezel-Setting
Quality Grade AAA
View More

Product Parent Collection Handle
black-onyx-earrings

FAQs About: Natural Black Onyx Sunburst Hoop Drop Earrings

What size and quality are the black onyx stones in these earrings?

The earrings contain two round natural black onyx gemstones measuring approximately 4 x 4 mm each. Together they weigh about 0.44 carat and have a brilliant cut with an AAA quality grade.

What setting is used for the black onyx gemstones?

Each round black onyx is secured in a bezel setting. The surrounding metal forms a defined border around the gemstone and complements the radiating sunburst design.

What makes the sunburst design distinctive?

The sunburst frame radiates outward around each dark round onyx, adding sculptural detail and visual contrast. The motif is suspended beneath the hoop so the gemstone element moves naturally when worn.

What are the dimensions of these black onyx drop earrings?

The earrings measure approximately 28 mm in length and 10.3 mm in width, creating a defined drop profile beneath the ear.

What metal and closure are used for these hoop drop earrings?

The confirmed design is crafted in 92.5 sterling silver and selected yellow or white gold options in 10K, 14K, and 18K with an approximate metal weight of 3.78 grams. The earrings use hinged hoops for secure and convenient wear.

Do these black onyx earrings come with a Certificate of Authenticity?

Rosec Jewels offers a Certificate of Authenticity with its jewelry for added purchase confidence. Pieces also go through stone inspection, setting security review, and finishing inspection before dispatch.

How should I care for natural black onyx hoop drop earrings?

Clean the earrings gently with a soft cloth and mild soapy water, then dry them carefully. Avoid harsh chemicals, abrasive cleaners, and strong impact, store them separately when not worn, and periodically check the bezel settings and hinged hoops for secure wear.