Natural Black Onyx and Diamond Flower Engagement Ring

0
Sale price $551 Regular price $619
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Choose a proposal ring with striking contrast and nature-inspired character in this natural black onyx and diamond floral engagement ring. A round black onyx anchors the design with deep color, while round and marquise diamond accents form a flower-inspired arrangement around it. The combination of a dark center stone and bright petal-like sparkle makes this ring a distinctive choice for engagements, anniversaries, romantic milestones, or someone drawn to alternative gemstone jewelry.

Natural Black Onyx Floral Engagement Ring with Diamond Accents

The centerpiece is one approximately 0.22 carat natural black onyx measuring about 4 x 4 mm. Its round shape and brilliant cut are secured in a claw setting and carry an AAA quality grade. Sixteen brilliant-cut diamonds contribute approximately 0.32 carat, combining twelve round stones measuring about 1.30 mm with four marquise stones measuring about 1.50 x 3.00 mm. The diamonds are graded HI color and SI quality, bringing the total approximate stone weight to 0.54 carat.

What Makes This Black Onyx Floral Engagement Ring Special

  • Floral-inspired arrangement: Round and marquise diamonds are positioned around the dark center to create a petal-like decorative composition.
  • AAA black onyx center: The 4 mm round gemstone provides a bold focal point with a deep black appearance.
  • Mixed-shape diamond accents: Round and marquise diamonds add varied sparkle and reinforce the floral theme.
  • Claw-set gemstones: The black onyx and diamond accents are secured in claw settings that keep their individual shapes clearly defined.
  • Metal: Available in 92.5 sterling silver and selected yellow or white gold options in 10K, 14K, and 18K. with an approximate metal weight of 2.52 grams.

Meaning Behind the Black Onyx and Diamond Floral Design

The floral arrangement gives this engagement ring a softer, nature-inspired frame around the bold black center stone. Marquise diamonds naturally resemble petals, while round diamonds add points of light between them, creating contrast and visual texture. For a proposal or meaningful gift, the blossom-inspired setting can represent growth and a relationship continuing to unfold, while the black onyx gives the design a strong, individual identity.

Black Onyx and Diamond Ring Authenticity & Craftsmanship

Rosec Jewels crafts this floral engagement ring with attention to gemstone alignment, secure claw settings, balanced diamond placement, and refined finishing. Rosec Jewels offers a Certificate of Authenticity with the jewelry, and each piece goes through stone inspection, setting security review, and finishing inspection before dispatch. For ongoing care, clean the ring gently with mild soap and warm water, dry it with a soft cloth, and protect it from harsh chemicals, abrasive surfaces, and strong impacts.

Styling a Natural Black Onyx Floral Engagement Ring

The round black center creates an immediate focal point from above, while the mix of round and marquise diamonds gives the ring decorative sparkle from different angles. Its black-and-white palette makes it easy to pair with formal or everyday looks, while the floral motif keeps the design romantic enough for a proposal. US ring sizes from 3 through 13 are available, including quarter-size increments for a more precise fit.

Product Information
SKU SHP-RINGS0821221644
Width 3.8 mm
Height 7 mm
Metal Weight 2.52 gm (Approximate)
Total Stone Weight 0.54 Carat (Approximate)
BLACK ONYX INFORMATION
No.of Stones 1 Pieces
Total Weight 0.22 Carat (Approximate)
Dimension(approx) Round-4X4 mm-1 Pcs
Color Black
Cut Brilliant
Shape Round
Setting Type Claw-Set
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 16 Pieces
Total Weight 0.32 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-12 Pcs
Marquise-1.50X3.00 mm-4 Pcs
Color HI
Cut Brilliant
Shape Round, Marquise
Setting Type Claw-Set
Quality Grade SI
View More

Product Parent Collection Handle
black-onyx-rings

FAQs About: Natural Black Onyx and Diamond Floral Engagement Ring

What size and quality is the black onyx in this floral engagement ring?

The ring contains one approximately 0.22 carat round black onyx measuring about 4 x 4 mm. It has a brilliant cut, AAA quality grade, and is secured in a claw setting.

How many diamonds are used in the black onyx floral ring?

The design includes 16 brilliant-cut diamonds totaling approximately 0.32 carat. Twelve are round diamonds measuring about 1.30 mm, while four are marquise diamonds measuring about 1.50 x 3.00 mm.

What gives this black onyx engagement ring its floral look?

The floral effect comes from the arrangement of round and marquise diamond accents around the central black onyx. The marquise stones create petal-like shapes while the round diamonds add extra sparkle and definition.

What setting is used for the black onyx and diamond accents?

The round black onyx and the round and marquise diamond accents are secured in claw settings, allowing each gemstone shape to remain clearly visible within the floral composition.

Is this natural black onyx ring suitable for an engagement?

Yes. Its central black onyx, diamond floral arrangement, and romantic blossom-inspired design make it a distinctive alternative engagement ring for someone who prefers a dark gemstone over a traditional light-colored center stone.

What metal and ring sizes are available?

The confirmed ring is crafted in 92.5 sterling silver and selected yellow or white gold options in 10K, 14K, and 18K with an approximate metal weight of 2.52 grams. US ring sizes are available from 3 through 13, including quarter-size increments.

How should I care for a black onyx and diamond engagement ring?

Clean the ring with warm water, mild soap, and a soft cloth or brush, then rinse gently and dry it with a soft cloth. Avoid harsh chemicals, abrasive cleaners, and strong impacts, and store the ring separately when it is not being worn.