Natural Aquamarine Flower Promise Ring with Diamond

0
Sale price $560 Regular price $629
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Blossom into forever with the ethereal charm of this Flower Promise Ring, a piece that captures the essence of love in full bloom. At its center lies a 4 mm Round Shape Aquamarine gemstone set in Claw Setting, radiating the soft blue of a sea. Surrounding the centerpiece, a Halo of sparkling Diamond stones adds a heavenly glow, while the Split Shank gracefully embraces the gem with exquisite artistry. On either side, two Marquise Shaped Diamond stones glimmer delicately like leaves, completing the floral motif with the poetry of nature. This Aquamarine Diamond Ring is a promise whispered in light, crafted for the woman whose love feels like a breath of fresh spring air. Elegant yet modern, this Aquamarine Flower Ring is the perfect gift for anniversaries, promises or simply to celebrate the beauty of your bond. Presented in a signature jewelry box and available in various ring sizes, this Split Shank Ring is designed to make every moment unforgettable. Radiant and romantic, this Aquamarine Promise Ring is a timeless treasure that lets your love bloom endlessly.

Product Information
SKU SHP-RINGS0821233432
Width 3.8 mm
Height 7 mm
Metal Weight 2.02 gm (Approximate)
Total Stone Weight 0.57 Carat (Approximate)
AQUAMARINE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.25 Carat (Approximate)
Dimension(approx) Round-4X4 mm-1 Pcs
Color Blue
Cut Brilliant
Shape Round
Setting Type Claw-Set
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 16 Pieces
Total Weight 0.32 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-12 Pcs
Marquise-1.50X3.00 mm-4 Pcs
Color HI
Cut Brilliant
Shape Round, Marquise
Setting Type Claw-Set
Quality Grade SI
View More

Product Parent Collection Handle
aquamarine-engagement-rings