Moissanite Chinese Fan Shaped Cartilage Earring

0
Regular price $559
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Distinctive Cartilage Earring with Artistic Influence

This moissanite cartilage earring draws inspiration from the elegant form of a traditional Chinese fan, creating a design that feels both artistic and contemporary. Its structured silhouette offers a refined alternative to minimal studs, making it suitable for those who prefer jewelry with a subtle yet expressive presence.

It is an ideal choice for curated ear styling, adding visual interest without overwhelming the overall look.

Thoughtful Design for Piercing Placement

Designed specifically for cartilage wear, the earring follows a shape that complements the natural contour of the ear. Its fan-like spread allows it to sit neatly within the piercing area, enhancing visibility while maintaining balance.

This ensures a secure and well-positioned appearance when worn in cartilage piercings such as helix or similar placements.

Moissanite for Subtle Brilliance

The use of moissanite introduces a refined sparkle that enhances the design without overpowering it. Known for its light performance, moissanite adds clarity and brightness, allowing the intricate shape of the earring to stand out.

It is created without traditional mining, though its overall impact varies by production and energy source.

Lightweight Feel for Daily Wear

Crafted for comfort, this cartilage earring is designed to remain lightweight and easy to wear throughout the day. Its size and structure allow it to sit comfortably without causing unnecessary pressure on the ear.

This makes it suitable for extended wear, including daily styling.

A Unique Addition to Curated Ear Looks

The fan-inspired motif adds dimension to ear styling, making it a strong standalone piece or a complement to other earrings. Its distinctive form helps create contrast when paired with simpler designs.

It works well within modern layered looks while retaining its own identity.

Designed for Individual Expression

With its unconventional shape and refined detailing, this earring offers a way to express personal style through thoughtful design. It suits those looking to move beyond traditional forms while maintaining a polished aesthetic.

It remains a versatile piece that can transition between everyday wear and more styled occasions.

Product Information
SKU SHP-BODYJ0921396962
Length 12 mm
Width 7.5 mm
Height 1.4 mm
Weight 0.72 gm (Approximate)
MOISSANITE INFORMATION
No.of Stones 21 Pieces
Total Weight 0.35 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-13 Pcs
Round-1.50X1.50 mm-8 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
helix-earrings

Faq About: Moissanite Chinese Fan Shaped Cartilage Earring

Is this earring suitable for cartilage piercings?
Yes, it is specifically designed for cartilage placements and fits comfortably in areas like the helix.
Will the design sit flat on the ear?
The fan-inspired shape is crafted to align with the ear’s contour, allowing it to sit securely and visibly.
Is this sold as a single earring or a pair?
Cartilage earrings are typically sold as a single piece; please refer to the product details for confirmation.
Can it be worn daily?
Yes, the lightweight design makes it suitable for daily wear without causing discomfort.
Does the moissanite sparkle noticeably?
Moissanite is known for its brightness and reflective qualities, offering a refined yet noticeable sparkle.
Is this earring easy to style with other pieces?
Yes, its unique shape pairs well with both minimal studs and layered ear styling for a curated look.