Modern Geometric Kite Shape Diamond Helix Earring

0
Sale price $545 Regular price $599
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Give a curated ear stack a sharp geometric focal point with this modern kite shape diamond helix earring. A pear-shaped natural diamond sits at the heart of the kite motif, surrounded by petite round diamonds that add controlled sparkle without making the design feel oversized. Finished with a flat back closure and sold as a single earring, it is designed for helix, cartilage, upper lobe, tragus, or conch styling and makes a distinctive gift for someone who prefers modern fine piercing jewelry.

Kite Shape Diamond Helix Earring with Pear and Round Natural Diamonds

The earring contains 15 natural diamonds with an approximate total weight of 0.18 carat. At the center is one pear-shaped diamond measuring approximately 2 x 3 mm, secured in a prong setting, while 14 round diamonds in approximately 0.90 mm, 1.00 mm, and 1.10 mm sizes form the surrounding detail. The diamonds have brilliant-cut faceting, HI color, and SI quality. The confirmed version is crafted in 10K yellow gold and measures approximately 8 mm long, 5 mm wide, and 2.5 mm high, with an approximate metal weight of 0.43 gram.

What Makes This Diamond Helix Earring Special

  • Kite-shaped motif gives the piercing earring a clean geometric profile.
  • One pear-shaped natural diamond measuring approximately 2 x 3 mm forms the center focal point.
  • Fourteen round natural diamond accents create fine sparkle around the kite design.
  • Fifteen diamonds total approximately 0.18 carat.
  • HI color and SI quality with brilliant-cut faceting.
  • Pear diamond is prong set, while the surrounding round diamonds are arranged in pavé-style detailing.
  • Flat back closure supports secure, low-profile wear.
  • Post lengths from 4.5 mm through 7.5 mm are available for different piercing fits.
  • Sold singly with left-ear or right-ear selection.

Why Choose a Kite Shape Diamond Cartilage Earring

The kite silhouette gives this diamond cartilage earring a more directional look than a conventional round stud, while the pear-shaped center adds a softer contrast within the angular outline. Small round diamonds distribute sparkle across the motif without overpowering its compact proportions. That balance makes the design especially useful for building a personalized ear stack, marking a piercing milestone, or gifting someone a piece that feels individual rather than traditional.

Natural Diamond Helix Earring Craftsmanship & Authenticity

Rosec Jewels crafts this diamond helix earring with attention to stone placement, secure settings, flat-back construction, and refined finishing. A Certificate of Authenticity is offered with Rosec Jewels jewelry for added purchase confidence. Each piece goes through stone inspection, setting security review, and finishing inspection before dispatch, with care guidance supporting long-term wear and maintenance.

Styling a Diamond Helix, Cartilage or Tragus Earring

The compact 8 x 5 mm kite profile creates a defined accent without taking over the ear. Wear it alone for a minimal geometric statement or combine it with small hoops, studs, and other piercing jewelry in a curated ear stack. The flat back and selectable post lengths make it adaptable to helix, cartilage, upper lobe, tragus, and conch placements, while left- and right-ear options help position the design as intended.

Product Information
SKU SHP-BODYJ082410077
Length 8 mm
Width 5 mm
Height 2.5 mm
Metal Weight 0.43 gm (Approximate)
Total Stone Weight 0.18 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 15 Pieces
Total Weight 0.18 Carat (Approximate)
Dimension(approx) Pear-2X3 mm-1 Pcs
Round-0.90X0.90 mm-10 Pcs
Round-1.10X1.10 mm-2 Pcs
Round-1X1 mm-2 Pcs
Color HI
Cut Brilliant
Shape Pear, Round
Setting Type Prong-Setting
Quality Grade SI
View More

FAQs About: Modern Kite Shape Diamond Helix Earring

What diamonds are used in this kite shape helix earring?

The earring features 15 natural diamonds totaling approximately 0.18 carat. The design combines one pear-shaped center diamond with 14 round diamond accents, all with brilliant-cut faceting, HI color, and SI quality.

What size is the pear-shaped diamond in the center?

The central pear-shaped natural diamond measures approximately 2 x 3 mm and is secured in a prong setting. Its elongated shape creates the main focal point within the geometric kite motif.

How are the round diamond accents arranged?

Fourteen round diamonds surround the pear-shaped center in the kite design. They measure approximately 0.90 mm, 1.00 mm, and 1.10 mm and are arranged as delicate pavé-style accents for added sparkle.

Which piercings can this diamond earring be worn in?

The design is suitable for helix, cartilage, upper lobe, tragus, and conch piercings. Its flat back closure creates a neat profile for these placements, and several post lengths are available to help accommodate different fits.

What post lengths are available for this flat back diamond helix earring?

The selectable flat back post lengths are 4.5 mm, 5.0 mm, 5.5 mm, 6.0 mm, 6.5 mm, 7.0 mm, and 7.5 mm. Choosing an appropriate length can help achieve a better fit for the intended piercing placement.

Is this kite shape diamond earring sold as a pair?

No. The earring is sold singly, making it well suited to a curated ear stack or individual piercing. A left-ear or right-ear option can also be selected.

Does this diamond helix earring come with a Certificate of Authenticity?

Yes. Rosec Jewels offers a Certificate of Authenticity with its diamond piercing jewelry for added purchase confidence. Pieces also go through stone inspection, setting security review, and finishing inspection before dispatch.