Modern Kite Shape Diamond Helix Earring

0
Sale price $545 Regular price $599
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Want to amp up your look with a minimal charm? Grab this Kite Shape Diamond Earring, showcasing pear shape diamond in the center set in prong setting, surrounded by dainty Round Diamonds secured by pave setting on a kite shaped motif. This Diamond Piercing Earring is a perfect choice to wear on your Helix, Cartilage, Upper Lobe, Tragus, or Conch Piercing. Flaunt it without any worries of falling, this Diamond Earring comes with a flat back closure to keep it secured in place. Want to gift something that your loved one remembers forever, this Helix Piercing Earring is an ideal present, she will surely adore it! Meticulously crafted from Hallmarked Metal, this Diamond Cartilage Earring is not only a fashionable choice but also a fantastic option for a variety of occasions. Make a statement with the trendy earring that is sure to attract attention, whether you are enjoying a casual outing or attending a special event. Whether paired with other minimalistic jewelry or worn solo as a statement piece, this piece effortlessly complements a variety of styles and occasions.

Product Information
SKU SHP-BODYJ082410077
Length 8 mm
Width 5 mm
Height 2.5 mm
Metal Weight 0.43 gm (Approximate)
Total Stone Weight 0.18 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 15 Pieces
Total Weight 0.18 Carat (Approximate)
Dimension(approx) Pear-2X3 mm-1 Pcs
Round-0.90X0.90 mm-10 Pcs
Round-1.10X1.10 mm-2 Pcs
Round-1X1 mm-2 Pcs
Color HI
Cut Brilliant
Shape Pear, Round
Setting Type Prong-Setting
Quality Grade SI
View More