Heart Shape Garnet Kissing Dolphin Stud Earrings

0
Regular price $329
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Show your love for the ocean and its most playful creature with these adorable Dolphin Stud Earrings. Perfect for animal lovers, these earrings beautifully capture the charm and spirit of dolphins in a cute and meaningful design. Curated with a lovely 4 MM heart shaped garnet gemstone held securely in place with a 3 prong setting. Surrounding the garnet are two beautifully crafted dolphins made from metal. The dolphins curve gently toward each other, forming a sweet heart shape around the center stone. This thoughtful design represents love, harmony, and the playful nature of dolphins, often known as the queens of the sea. The combination of the heart shaped garnet and the dolphin motif makes these Garnet Stud Earrings both cute and meaningful. These Dolphin Heart Earrings are lightweight and comfortable, making them perfect for everyday wear. Whether you are heading out for a casual day, meeting friends, or simply want to add a fun ocean inspired touch to your look, these Animal Stud Earrings make a lovely choice. For added safety and comfort, they come with a secure screw back closure that helps them sit snugly on the earlobe throughout the day.

Product Information
SKU SHP-EARRINGS042163607
Length 9.8 mm
Width 11.9 mm
Metal Weight 2.50 gm (Approximate)
Total Stone Weight 0.76 Carat (Approximate)
GARNET INFORMATION
No.of Stones 2 Pieces
Total Weight 0.76 Carat (Approximate)
Dimension(approx) Heart-4X4 mm-2 Pcs
Color Red
Cut Brilliant
Shape Heart
Setting Type 3-Prong-Setting
Quality Grade AAA
View More

Product Parent Collection Handle
january-birthstone-jewelry