Diamond Flower Stud Earrings With Screw Back

0
Sale price $295 Regular price $339
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Sparkle the grace of your style with these Diamond Flower Earrings. These Stud Earrings feature Round Shaped Diamond in the center in Bezel Setting along with the Petals that are adorned with Diamond. Known for natural radiance and timeless elegance, these Flower Stud Earrings make a stunning addition to the jewelry collection. Having the perfect combination of luxury and subtle beauty, these Floral Earrings have a luminous sheen and delicate hues, having unique iridescence reflecting light beautifully. The feminine twist with the flower design enhances the style that would let you feel fresh. The timeless flower motif exudes a refined charm that complements any style. So, embrace the beauty with style and design, bloom with shining petals paved with glistening round diamonds. In a nod to Mother Earth, these charming Floral Stud Earrings add a pop of sunshine to your signature look that effortlessly enchants, pairing to bring natures most timeless beauty to your radiant style, every day.

Product Information
SKU SHP-EARRINGS111910134
Length 8.4 mm
Width 8.4 mm
Height 2 mm
Metal Weight 1.65 gm (Approximate)
Total Stone Weight 0.66 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 18 Pieces
Total Weight 0.66 Carat (Approximate)
Dimension(approx) Round-1.60X1.60 mm-16 Pcs
Round-2.40X2.40 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Bezel-Setting
Quality Grade SI
View More