Diamond Flower Petal Stud Earrings in Prong Setting

0
Sale price $260 Regular price $299
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Delicate, bright, and full of meaning, these Diamond Flower Petal Stud Earrings bring a soft nature-inspired charm to everyday jewelry. Each stud is shaped with polished metal petals that frame a round brilliant diamond, creating the look of a tiny blooming flower with a refined sparkle at its heart. The design feels personal without being overly ornate, making it a thoughtful choice for birthdays, fresh beginnings, romantic gestures, or a just-because gift with lasting sentiment.

Brilliant Cut Round Diamond Flower Petal Stud Earrings

Crafted as petite floral, these stud earrings pair round brilliant cut diamonds with secure prong settings and a flower-petal metal silhouette. The design measures approximately 6.6 mm in length and 7 mm in width, giving the earrings a graceful presence that sits neatly on the ear. With an approximate total diamond weight of 0.17 carat across two stones, they offer a gentle shimmer suited for daily styling, meaningful gifting, and understated occasion wear.

What Makes This Special

  • Flower-inspired stud earrings with polished metal petals surrounding each diamond.
  • Two round shape diamonds with an approximate total weight of 0.17 carat.
  • Brilliant cut diamonds designed to bring lively sparkle to the petite floral form.
  • Prong setting that keeps each diamond visually open while holding it securely.
  • Approximate diamond dimensions of 2.60 x 2.60 mm for each stone.
  • Natural diamond details include HI color and SI quality grade.
  • Gemstone quality options include Lab - EF-VS and Natural - HI-SI.
  • Available in 92.5 sterling silver, 10K yellow gold, 10K white gold, 14K yellow gold, 14K white gold, 18K yellow gold, and 18K white gold.
  • Approximate metal weight is 1.61 gm.

Why Choose This Design

The floral outline gives these diamond studs a softer identity than classic solitaire earrings, while the round brilliant cut keeps the sparkle crisp and familiar. Prong settings allow more light to reach the diamonds, helping the stones appear bright within the petal frame. Their compact size makes them easy to wear from morning to evening, and the choice of sterling silver or yellow and white gold options allows the design to match different jewelry wardrobes and personal preferences.

Design Meaning

A flower motif carries a natural sense of hope, renewal, affection, and joy. In these earrings, the diamond at the center of each bloom adds a quiet note of love and celebration, while the petal-inspired setting gives the piece a tender, feminine character. They make a meaningful gift for someone beginning a new chapter, celebrating a milestone, or simply deserving a reminder of care and appreciation.

Authenticity & Craftsmanship

Each pair is carefully crafted with attention to proportion, stone placement, setting security, and refined finishing. Rosec Jewels offers a Certificate of Authenticity with the jewelry, supporting confidence in the piece you receive. Before dispatch, the earrings go through stone inspection, setting security review, and finishing inspection to help ensure the diamonds are properly placed and the surface is polished for comfortable wear. Care guidance is also part of the customer support experience, helping you preserve the shine and detail of the earrings over time.

Style and Wearability

These flower stud earrings are made for effortless styling. Their petite floral shape adds charm without overpowering the face, making them suitable for workdays, casual outfits, date nights, and special celebrations. They can be worn alone for a clean diamond accent or paired with a delicate pendant, bracelet, or floral jewelry piece for a coordinated look. Their gifting appeal comes from the balance of sparkle, symbolism, and easy everyday wear.

Product Information
SKU SHP-EARRINGS111910163
Length 6.6 mm
Width 7 mm
Metal Weight 1.61 gm (Approximate)
Total Stone Weight 0.17 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 2 Pieces
Total Weight 0.17 Carat (Approximate)
Dimension(approx) Round-2.60X2.60 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
flower-jewelry

FAQs About: Diamond Flower Petal Stud Earrings in Prong Setting

What makes these Diamond Flower Petal Stud Earrings a meaningful gift?

The floral design symbolizes joy, renewal, affection, and fresh beginnings, while the diamond center adds a lasting sense of celebration. Their petite stud style makes them easy to gift for birthdays, milestones, romantic occasions, or everyday appreciation.

What diamond cut and setting are used in these earrings?

These earrings feature round brilliant cut diamonds secured in prong settings. The prong setting helps keep the diamonds visibly open, allowing their sparkle to stand out within the flower-petal design.

How much diamond weight do these flower stud earrings have?

The earrings have an approximate total diamond weight of 0.17 carat across two round diamonds. Each diamond measures approximately 2.60 x 2.60 mm.

Are these earrings solitaire studs or floral diamond studs?

They are floral diamond stud earrings. Each stud has a round diamond at the center, surrounded by metal petals that create a flower-inspired silhouette rather than a plain solitaire look.

What metal options are available for these diamond earrings?

These earrings are available in 92.5 sterling silver, 10K yellow gold, 10K white gold, 14K yellow gold, 14K white gold, 18K yellow gold, and 18K white gold.

Do these earrings come with authenticity assurance?

Yes. Rosec Jewels offers a Certificate of Authenticity with each piece. The earrings also go through stone inspection, setting security review, and finishing inspection before dispatch.

How should I care for these diamond flower stud earrings?

Store them separately in a soft jewelry pouch or box, avoid harsh chemicals, and remove them before swimming, heavy workouts, or cleaning. Gently wipe them with a soft cloth after wear to help maintain their shine and polished finish.