Designer Certified Moissanite Wedding Band for Women

0
Regular price $379
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Created for a love story with character, this designer certified moissanite wedding band brings intricate detail and radiant sparkle into a refined half eternity silhouette. Round moissanite stones are arranged in a repeating loop pattern across the band, while delicate beaded edges add a vintage-inspired touch. Whether chosen for a wedding, anniversary, milestone celebration, or meaningful stack, the ring offers a distinctive alternative to a simple band with a design that feels romantic, expressive, and thoughtfully crafted.

Round Moissanite Wedding Band for Women

This moissanite wedding band is crafted with 20 round white moissanite stones in D-VS1 quality, creating an approximate total stone weight of 1.53 carats. The brilliant cut stones are secured in prong settings and arranged in a half eternity loop design that gives the ring graceful sparkle across the finger. With an approximate weight of 4.10 gm and metal choices from sterling silver to 10K, 14K, and 18K gold, it is designed for women who want a wedding or anniversary band with detail, shine, and personality.

What Makes This Special

The ring features 20 round moissanite stones with an approximate total weight of 1.53 carats. The stone layout includes 14 round moissanites measuring approximately 2 x 2 mm and 6 round moissanites measuring approximately 3 x 3 mm, creating a balanced mix of delicate sparkle and larger light-catching accents.

The moissanites are white in color, round in shape, brilliant cut, D-VS1 quality grade, and secured in prong settings. The repeating loop design circles the visible portion of the finger in a half eternity style, giving the band an artistic, openwork look.

The ring has an approximate weight of 4.10 gm. Metal options include 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold. Ring sizes are available from US 3 to US 13, including quarter-size options.

Why Choose This Design

A half eternity band offers sparkle across the front of the finger while keeping the design practical for regular wear. The loop pattern gives this ring more visual movement than a straight row band, making it a strong choice for someone who wants a wedding band with artistry rather than a plain setting.

The round brilliant moissanite stones bring lively reflection, while the prong setting keeps each stone visible and bright. Beaded edges add fine texture and a vintage-inspired finish, helping the ring feel detailed from every angle without losing its graceful wearability.

Design Meaning

The repeating loop motif can symbolize continuity, connection, and the rhythm of a shared life. In a half eternity wedding band, that pattern becomes a meaningful expression of lasting love, steady commitment, and memories that continue to grow. The moissanite sparkle adds a celebratory feeling, making the ring fitting for weddings, anniversaries, vow renewals, or any milestone rooted in devotion.

Authenticity & Craftsmanship

Each ring is carefully crafted with attention to moissanite selection, loop alignment, prong setting security, beaded edge detail, smooth finishing, and balanced proportions. Rosec Jewels offers a Certificate of Authenticity with the product, adding confidence to the purchase experience. Before dispatch, every piece goes through stone inspection, setting security review, and finishing inspection to help ensure it is ready for wearing or gifting. For lasting care, store the ring separately, avoid harsh chemicals, and wipe it gently with a soft cloth after wear.

Style and Wearability

This designer moissanite band can be worn as a wedding band, anniversary ring, stackable ring, or statement band on its own. The wider patterned profile gives it presence, while the half eternity layout keeps it comfortable for meaningful everyday wear with care. It pairs beautifully with solitaire engagement rings, plain gold bands, slim moissanite rings, and both warm or cool metal jewelry depending on the selected metal.

Product Information
SKU SHP-RINGS032223082
Weight 4.10 gm (Approximate)
Center Stone Weight 1.53 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 20 Pieces
Total Weight 1.53 Carat (Approximate)
Dimension(approx) Round-2X2 mm-14 Pcs
Round-3X3 mm-6 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-rings

FAQs About: Designer Certified Moissanite Wedding Band for Women

What makes this moissanite wedding band meaningful?

The half eternity design and repeating loop pattern can symbolize ongoing love, connection, and commitment. Its detailed moissanite sparkle makes it a thoughtful choice for weddings, anniversaries, vow renewals, or milestone celebrations.

How many moissanite stones are used in this ring?

The ring includes 20 round moissanite stones with an approximate total weight of 1.53 carats. The layout includes 14 round stones measuring approximately 2 x 2 mm and 6 round stones measuring approximately 3 x 3 mm.

What cut, color, and quality are listed for the moissanite?

The moissanite stones are round in shape, white in color, and brilliant cut. They are listed with a D-VS1 quality grade.

What setting style is used for this wedding band?

The round moissanite stones are secured in prong settings. This setting style keeps the stones visible while supporting the repeating loop pattern across the half eternity design.

Is this a full eternity or half eternity band?

This is a half eternity band. The moissanite stones and loop pattern decorate the visible portion of the ring, giving the front of the band sparkle and detail while keeping the design practical for regular wear.

What metal options are available for this moissanite ring?

This design is available in 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold, giving buyers several choices in metal tone and purity.

How should I care for this designer moissanite wedding band?

Store the ring separately to help prevent scratches, avoid harsh chemicals, and wipe it gently with a soft cloth after wear. For deeper cleaning, use mild soap, lukewarm water, and a soft brush, then dry the ring carefully before storing.