Certified Real Ruby Flower Stud Earrings with Diamonds

0
Regular price $220
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold Plated Silver
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Stand out with these Flower Stud Earrings, a perfect blend of vibrant color and delicate design. At the center of each earring is a 2X3 mm Oval Shape Ruby of AAA Quality, its deep red hue symbolizing passion and love. Surrounding the ruby is a graceful flower motif, subtly designed to highlight the beauty of the center stone while adding a touch of feminine charm. Sparkling EF-VS Quality Lab Grown Diamond stones are carefully placed over the flower design, enhancing the overall brilliance and giving the earrings a sparkle that catches the light from every angle. Crafted in Yellow Gold Plated Sterling Silver, these Ruby Flower Earrings beautifully complement your every look for any occasion. Secured with Screw Back Closure, these Ruby Stud Earrings ensure that they stay perfectly in place throughout the day. Ideal for both everyday wear and special occasions, these Natural Ruby Earrings make a thoughtful gift for a loved one or a stunning addition to your own collection. Presented in a signature jewelry box, these Flower Studs are ready to gift or cherish. These Ruby Diamond Earrings combine classic beauty with a touch of floral grace, creating a timeless accessory that never goes out of style

Product Information
SKU RCEA062510077-FBA
Weight 1.80 gm (Approximate)
Center Stone Weight 0.14 Carat (Approximate)
RUBY INFORMATION
No.of Stones 2 Pieces
Total Weight 0.14 Carat (Approximate)
Dimension(approx) Oval-2X3 mm-2 Pcs
Color Red
Cut Brilliant
Shape Oval
Setting Type Prong-Setting
Quality Grade AAA
LAB GROWN DIAMOND INFORMATION
No.of Stones 90 Pieces
Total Weight 0.44 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-12 Pcs
Round-1X1 mm-78 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More