Certified Moissanite Shooting Star Pendant with Silver Chain

0
Sale price $104 Regular price $130
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Star Icon

With 18 Inch Chain


Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

A design inspired by the beauty of a shooting star, this Moissanite Star Pendant brings a magical and dreamy touch to your jewelry collection. The pendant is handcrafted in 14k white gold plated silver and features an open circular frame lined with tiny moissanite stones that create a continuous sparkle. Cutting across the circle is a sleek metallic bar, also adorned with petite stones, leading to a delicate star motif that completes the celestial look. The combination of the circle and star gives the Moissanite Pendant a unique and meaningful feel, symbolizing hope, love, and special moments that shine bright. The D-VS1 quality moissanite stones add a brilliant shine, reflecting light beautifully. Lightweight and thoughtfully designed, this Shooting Star Necklace sits comfortably on the neckline and pairs well with both everyday outfits and dressy looks. It is perfect for adding a subtle yet eye-catching detail to your style. Whether you are celebrating a special occasion or simply want to gift something meaningful, this Moissanite Eternity Necklace makes a lovely choice. It is a piece that feels personal and stylish at the same time, making it easy to wear and cherish for years to come.

Product Information
SKU RCPE082410102-FBA
Weight 4.10 gm (Approximate)
Total Stone Weight 0.74 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 34 Pieces
Total Weight 0.74 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-2 Pcs
Round-0.90X0.90 mm-3 Pcs
Round-1.10X1.10 mm-3 Pcs
Round-1.20X1.20 mm-4 Pcs
Round-1.40X1.40 mm-3 Pcs
Round-1.50X1.50 mm-1 Pcs
Round-1.60X1.60 mm-3 Pcs
Round-1.70X1.70 mm-6 Pcs
Round-1.90X1.90 mm-6 Pcs
Round-1X1 mm-3 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More