Certified Moissanite Floral Engagement Ring with Split Shank

0
Sale price $312 Regular price $359
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

This stunning Moissanite Flower Ring is a unique blend of artistry and sparkle, designed to make every moment feel special. At the center, a brilliant 5 MM round cut moissanite securely held by prong setting. Surrounding the center stone is a floral halo, creatively crafted from small round moissanite stones arranged like delicate petals. The design gives the Flower Engagement Ring a refined yet bold character that feels elegant and fresh. The split shank adds an open, airy feel that balances the detailed floral setting. The overall look is a mix of modern structure and floral softness, ideal for someone who appreciates fine design with a personal touch. Whether you are choosing it as an engagement ring or wearing it as a statement cocktail piece, this Moissanite Engagement Ring stands out effortlessly. The flower motif adds a romantic feel, while the split band and precise stone placement give it a unique, contemporary edge. The D-VS1 quality moissanite stone offers brilliant sparkle and is known for its durability, making this Cocktail Ring perfect for everyday wear or special occasions. It is a great way to express individuality and style through something meaningful and beautifully made.

Product Information
SKU SHP-RINGS032223483
Metal Weight 3.50 gm (Approximate)
Center Stone Weight 0.52 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 49 Pieces
Total Weight 0.85 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-24 Pcs
Round-1.10X1.10 mm-8 Pcs
Round-1.40X1.40 mm-4 Pcs
Round-1X1 mm-12 Pcs
Round-5X5 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-rings