Certified Moissanite Disc Capricorn Zodiac Pendant

0
Regular price $429
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Personal Symbol in Refined Form

This Certified Moissanite Disc Capricorn Zodiac Pendant is designed for those who value both symbolism and subtle brilliance. The disc silhouette provides a clean canvas for the Capricorn motif, making it a meaningful piece for personal wear or gifting.

Its balanced proportions allow it to layer easily or stand alone as a signature zodiac necklace.

Disc Design with Zodiac Detailing

The circular disc form represents wholeness and continuity, while the Capricorn zodiac detailing adds personal identity. The integration of moissanite accents introduces refined sparkle without overwhelming the symbolic design.

The smooth surface and structured layout ensure the pendant remains versatile for daily styling.

Moissanite Brilliance

Moissanite is chosen for its strong light performance and durability, making it well-suited for jewelry intended for regular wear. Its brilliance complements the engraved or structured zodiac detailing on the disc.

Moissanite is created without traditional mining, though impact varies by production and energy source.

High-Level Features

This pendant features a Capricorn zodiac disc design accented with moissanite. The piece combines symbolic meaning, subtle sparkle, and a clean, circular profile suitable for everyday wear or special occasions.

Product Information
SKU SHP-PENDANT042210286
Metal Weight 5.80 gm (Approximate)
Total Stone Weight 1.02 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 71 Pieces
Total Weight 1.02 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-2 Pcs
Round-1.20X1.20 mm-66 Pcs
Round-1.10X1.10 mm-3 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
capricorn-zodiac-sign-jewelry

FAQs About: Certified Moissanite Capricorn Zodiac Disc Pendant

What does the Capricorn zodiac symbol represent?
Capricorn is often associated with discipline, ambition, and resilience, making it a meaningful zodiac choice for those born under this sign.
Is this pendant suitable for everyday wear?
Yes, the disc design and moissanite accents make it appropriate for daily wear while still offering refined sparkle.
Can this zodiac pendant be layered with other necklaces?
The clean disc shape makes it easy to layer with shorter or longer chains for a personalized necklace stack.
How should I clean a moissanite zodiac pendant?
Clean gently using mild soap and lukewarm water with a soft cloth or brush, then dry thoroughly before storing.
Is this pendant appropriate as a zodiac gift?
Yes, a Capricorn zodiac pendant is a thoughtful gift choice for birthdays or milestone occasions tied to the wearer’s astrological sign.