Certified Moissanite Cross Pendant with Silver Chain

0
Sale price $91 Regular price $130
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Star Icon

With 18 Inch Chain


Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Celebrate your faith with this Moissanite Cross Pendant, crafted with white gold plated silver. The pendant features a Cross symbol on which a swirl motif is overlapping, studded with Prong Set round cut Moissanite stones of D-VS1 Quality. This Christ Pendant is the symbol of spirituality and belief, which keeps you grounded in your religion. The pendant dangles with a silver cable chain with a lobster clasp that can be adjusted as per your comfort. Also, this Crucifix Necklace can be a great choice of gift for someone who holds deep faith in God and can be presented on Christmas and Easter. This piece serves wonderfully as a religious symbol while seamlessly integrating into both everyday and special occasion styles. Ideal for birthdays, anniversaries, Christmas, holidays, New Year, or Valentine’s Day, this Moissanite Pendant Necklace is a thoughtful gift for a wife, daughter, mother, friend, or any woman who appreciates significant jewelry. Crafted with meticulous care and attention to detail, this Cross Necklace combines faith, sentiment, and contemporary design into a truly unforgettable piece.

Product Information
SKU RCPE082410076-FBA
Weight 3.51 gm (Approximate)
Total Stone Weight 0.61 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 34 Pieces
Total Weight 0.61 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-8 Pcs
Round-0.90X0.90 mm-4 Pcs
Round-1.10X1.10 mm-1 Pcs
Round-1.20X1.20 mm-2 Pcs
Round-1.30X1.30 mm-1 Pcs
Round-1.40X1.40 mm-5 Pcs
Round-1.50X1.50 mm-6 Pcs
Round-1.60X1.60 mm-5 Pcs
Round-1.70X1.70 mm-1 Pcs
Round-2X2 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade D-VS1
View More