Certified Moissanite and Garnet Designer Bridal Necklace in Silver

0
Sale price $112 Regular price $140
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Star Icon

With 18 Inch Chain


Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Grace your bridal outfit with this stunning Designer Flower Necklace, made to make hearts skip a beat. The center features three pear cut garnet stones of AAA quality clustered in a delicate floral motif, surrounded by a halo of round cut moissanite stones that adds sparkle from every angle. Hanging gracefully from the floral design is a 7 MM round cut Moissanite drop of D-VS1 quality, securely set in prong setting. The Moissanite and Garnet Necklace is crafted in 14K white gold plated sterling silver, giving it a luxurious shine while keeping it lightweight and comfortable to wear all day long. It is connected with a sturdy cable chain, which has a lobster clasp that allows you to adjust the length for a perfect fit. This Drop Necklace is more than just jewelry - it is a symbol of elegance, love, and unforgettable moments. Wear it solo to allow it to stand out as a statement piece, or combine it with other necklaces for a fashionable layered appearance. Ideal for special events, romantic evenings, parties, or simply to elevate your daily attire, this Designer Wedding Necklace is adaptable and brimming with character. It arrives beautifully packaged in a jewelry box, perfect for gifting or storing.

Product Information
SKU RCPE082410131-FBA
Weight 4.51 gm (Approximate)
Center Stone Weight 1.36 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 27 Pieces
Total Weight 1.80 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-1 Pcs
Round-1.25X1.25 mm-25 Pcs
Round-7X7 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
GARNET INFORMATION
No.of Stones 3 Pieces
Total Weight 0.90 Carat (Approximate)
Dimension(approx) Pear-3X5 mm-3 Pcs
Color Red
Cut Brilliant
Shape Pear
Setting Type Prong-Setting
Quality Grade AAA
View More