Certified Lab Grown Diamond Zodiac Virgo Necklace

0
Regular price $399
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Personal Expression with Zodiac Meaning

The Certified Lab Grown Diamond Zodiac Virgo Necklace brings together symbolic design and refined craftsmanship. Created for those who connect with their zodiac identity, it offers a meaningful way to express individuality through jewelry.

Its thoughtful design allows it to be worn as a daily piece while maintaining a sense of personal significance.

Zodiac-Inspired Design with Balanced Detail

The Virgo motif is crafted with attention to proportion, ensuring the design remains clear and visually balanced. Diamond accents are placed to enhance the form without overwhelming the overall structure.

This approach keeps the necklace elegant and easy to style across different occasions.

Lab Grown Diamonds with Modern Appeal

Lab grown diamonds offer a consistent appearance and are generally suitable for everyday wear. Their structured brilliance supports both minimal and statement styling.

They are created without traditional mining, and their impact varies by production and energy source.

High-Level Features Buyers Appreciate

The necklace combines symbolic meaning with a clean design, making it suitable for layering or wearing on its own. Its balanced size allows it to remain noticeable without being overly bold.

The thoughtful construction ensures it sits comfortably, supporting regular use as a personal and versatile accessory.

Product Information
SKU SHP-PENDANT0921397843
Length 18.5 mm
Width 16.5 mm
Weight 3.80 gm (Approximate)
Center Stone Weight 0.49 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 50 Pieces
Total Weight 0.49 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-6 Pcs
Round-1.30X1.30 mm-43 Pcs
Round-1.50X1.50 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade EF-VS
View More

Product Parent Collection Handle
virgo-zodiac-sign-jewelry

FAQs About: Certified Lab Grown Diamond Zodiac Virgo Necklace

What does a Virgo zodiac necklace represent?
A Virgo zodiac necklace represents traits associated with the Virgo sign, often linked to precision, practicality, and attention to detail.
Are lab grown diamonds suitable for daily wear?
Yes, lab grown diamonds are generally suitable for everyday wear due to their durability and consistent appearance.
Can this necklace be worn every day?
Yes, its balanced design makes it suitable for daily wear with proper care.
Is this necklace suitable as a gift?
Yes, zodiac jewelry is often chosen as a meaningful gift, especially for individuals who identify with the Virgo sign.
Can this necklace be layered with other pieces?
Yes, its clean and minimal design allows it to be paired with other necklaces for a layered look.
Who is this necklace ideal for?
It is ideal for individuals who want to express their zodiac identity through a refined and wearable design.