Certified Lab Grown Diamond Flower Wrap Engagement Ring

0
Sale price $321 Regular price $369
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Made for a love story that feels graceful, personal, and a little unexpected, the Lab Grown Diamond Flower Wrap Engagement Ring brings a romantic floral silhouette to a modern open-ended design. Two diamond flowers rest at the ends of a delicate wrap band, creating a meaningful two-soul motif that feels intimate for a proposal, anniversary, promise, or milestone gift.

Each flower is formed with round lab grown diamonds in prong settings, allowing the design to feel airy while keeping the sparkle bright and defined. The curved band wraps softly around the finger, giving the ring a fresh engagement-ring profile with the comfort and visual movement of a cuff-inspired style.

Certified Lab Grown Diamond Flower Wrap Engagement Ring

This floral diamond engagement ring is crafted with 14 round lab grown diamonds totaling approximately 0.56 carat. The diamonds have EF-VS quality, white color, brilliant cut, and are set in secure prong settings. Available in 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold, the design can be chosen in the metal tone that best matches the wearer’s style.

What Makes This Special

  • Two floral diamond motifs create a symbolic wrap design with a romantic two-soul expression.
  • 14 round lab grown diamonds offer a total diamond weight of approximately 0.56 carat.
  • Brilliant-cut diamonds add lively sparkle across both flower forms.
  • Prong settings keep the stones securely placed while allowing light to reach each diamond.
  • The open-ended wrap band gives the ring a graceful, contemporary profile.
  • Available in sterling silver and multiple white or yellow gold options.

Why Choose This Design

The flower wrap style is ideal for someone who wants an engagement ring with softness, symbolism, and a less conventional silhouette. Round brilliant diamonds bring familiar sparkle, while the floral arrangement gives the ring a more expressive character than a classic solitaire. The open-ended band adds visual movement and makes the two flower motifs feel connected without being overly ornate.

Prong settings are a thoughtful choice for this design because they help each small round diamond catch light from different angles. The result is a ring that feels delicate on the hand yet meaningful in detail, with a balanced look that can suit both everyday romance and special celebrations.

Design Meaning

The two flower design carries a tender message: two lives growing together while keeping their own individual beauty. Flowers often symbolize affection, renewal, devotion, and celebration, making this diamond ring a fitting choice for a proposal or promise that feels deeply personal. The wrap band adds to the sentiment by creating a sense of closeness, as if the two floral forms are gently drawn toward one another.

Authenticity & Craftsmanship

This ring is carefully crafted with attention to stone placement, setting security, and refined finishing. Rosec Jewels offers a Certificate of Authenticity with the piece, supporting confidence in the jewelry and its stated details. Before dispatch, each piece goes through stone inspection, setting security review, and finishing inspection. To help preserve its finish and sparkle, keep the ring away from harsh chemicals, store it safely when not in use, and clean it gently with suitable jewelry care methods.

Style and Wearability

The floral wrap profile gives this ring a graceful look from the top while adding dimension along the finger. Its open-ended design makes it feel modern without losing the romantic appeal expected from an engagement ring. It can be worn as a proposal ring, a meaningful promise ring, or a sentimental gift for someone who loves nature-inspired jewelry with refined diamond sparkle.

The choice of sterling silver, white gold, or yellow gold allows the design to be tailored to different preferences. White metal options highlight the cool brightness of the diamonds, while yellow gold adds a warmer contrast to the floral setting.

Product Information
SKU SHP-RINGS022510069
Weight 2.24 gm (Approximate)
Center Stone Weight 0.56 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 14 Pieces
Total Weight 0.56 Carat (Approximate)
Dimension(approx) Round-2.10X2.10 mm-14 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More

FAQs About: Certified Lab Grown Diamond Flower Wrap Engagement Ring

What makes this lab grown diamond flower wrap ring suitable for a proposal?

The ring combines romantic symbolism with a distinctive engagement-ring silhouette. Its two diamond flowers can represent two souls coming together, while the wrap band adds a personal, modern feel that makes it meaningful for a proposal, promise, or anniversary.

What diamonds are used in this flower engagement ring?

This ring is set with 14 round lab grown diamonds totaling approximately 0.56 carat. The diamonds are white in color, brilliant cut, and graded EF-VS for color and clarity.

What setting style is used for the diamonds?

The round lab grown diamonds are secured in prong settings. This setting style helps hold each diamond in place while allowing light to reach the stones for a bright, lively look.

Does this ring have a solitaire or accent-stone design?

This is not a solitaire design. The ring features two flower motifs made from multiple round diamonds, creating a floral accent-style look across an open-ended wrap band.

Which metal options are available for this ring?

The ring is available in 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold.

Does this ring come with authenticity details?

Yes. Rosec Jewels offers a Certificate of Authenticity with the it, and the ring also falls under certified jewelry details with quality checks before dispatch.

How should I care for this diamond flower wrap ring?

Store the ring separately when not in use, avoid harsh chemicals, and clean it gently with appropriate jewelry care methods. Regularly checking the prong settings can also help keep the diamonds secure over time.