Certified Lab Grown Diamond Art Deco Flower Engagement Ring

0
Sale price $443 Regular price $509
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


An Art Deco Floral Design with Distinct Character

The Certified Lab Grown Diamond Art Deco Flower Engagement Ring blends geometric precision with floral inspiration. Designed for those who appreciate vintage artistry, this ring features a structured flower motif that reflects the symmetry and detailing associated with the Art Deco era. It offers a meaningful alternative to traditional solitaires while maintaining a refined and balanced appearance.

Design and Setting Structure

The flower-inspired arrangement creates dimension around the center diamond, enhancing visual depth without overwhelming the overall silhouette. Art Deco styling emphasizes clean lines and intentional symmetry, giving the ring a defined and architectural presence on the finger. The setting is crafted to securely hold each diamond in place while preserving a smooth and wearable profile.

Lab Grown Diamond Value

This ring features lab grown diamonds that share the same physical and optical properties as mined diamonds. They are created without traditional mining, though impact varies by production and energy source. When cared for properly, lab grown diamonds are suitable for everyday wear, making them a practical choice for engagement jewelry.

High-Level Features

  • Art Deco-inspired floral engagement ring design.
  • Certified lab grown diamonds set in a structured motif.
  • Crafted in precious metal options listed in the product specification tables.
  • Designed to combine vintage influence with contemporary wearability.
Product Information
SKU SHP-RINGS052410102
Metal Weight 3.20 gm (Approximate)
Center Stone Weight 0.99 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 25 Pieces
Total Weight 1.18 Carat (Approximate)
Dimension(approx) Round-6X6 mm-1 Pcs
Round-1.20X1.20 mm-24 Pcs
Color E-F
Cut Brilliant
Shape Round
Setting Type 6-Prong-Setting
Quality Grade VS
View More

FAQs about: Lab Grown Diamond Art Deco Flower Engagement Ring

Are the diamonds in this ring certified?
Yes, this ring includes certified lab grown diamonds. Specific certification details can be found in the product information tables above.
Is an Art Deco engagement ring suitable for daily wear?
Art Deco designs are suitable for everyday wear when crafted with proper structure and care. Routine cleaning and periodic inspection help maintain long-term durability.
What makes this ring “Art Deco” in style?
The Art Deco influence comes from its geometric symmetry, defined lines, and structured floral motif that reflect design principles from the early 20th century.
What metal options are available?
Available metal options are listed in the product detail tables above. Please refer to that section for accurate and current information.
How should I care for this engagement ring?
Clean the ring gently using mild soap, warm water, and a soft brush. Rinse thoroughly and dry with a lint-free cloth. Professional inspection is recommended periodically to ensure the setting remains secure.