Certified 0.9 Carat Oval Shaped Moissanite Flower Pendant Necklace

0
Regular price $150
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Star Icon

With 18 Inch Chain


Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Upgrade your everyday sparkle with this stunning Moissanite Pendant Necklace that blends floral charm with modern style. The pendant showcases a brilliant 5X7 MM oval shaped moissanite secured in prong setting, catching the light beautifully with every movement. Accenting the top of the Oval Shape Pendant is a delicate floral motif, studded with shimmering moissanites that add extra shine and a graceful touch to the overall design. Handcrafted in 14K white gold plated sterling silver, this Floral Pendant Necklace offers a bright finish that pairs effortlessly with both casual and dressy looks. The stones are graded D color with VS1 clarity, giving the Moissanite Flower Necklace a timeless sparkle that stands out while staying easy to wear. The hidden bail keeps the focus on the design and allows the pendant to sit neatly along the neckline. Suspended from a sturdy cable chain, this Stackable Necklace layers beautifully with another neck piece or makes a statement on its own. Comfortable, stylish, and full of detail, it is a piece you will reach for again and again. Whether worn daily or saved for special moments, it adds charm, shine, and personality to any jewelry collection.

Product Information
SKU RCPE082410068-FBA
Weight 2.81 gm (Approximate)
Center Stone Weight 1.08 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 11 Pieces
Total Weight 1.08 Carat (Approximate)
Dimension(approx) Oval-5X7 mm-1 Pcs
Round-1.10X1.10 mm-10 Pcs
Color White
Cut Brilliant
Shape Oval, Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More