Bezel Set Lab Grown Diamond Solitaire Necklace With Cute Bow

0
Regular price $839
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

A timeless treasure for the woman who wants to shine brightly on special occasions, this Diamond Bow Necklace is a perfect blend of elegance and sparkle. It features an 8 MM round shaped diamond in the center set in bezel setting, above this centerpiece a dazzling bow motif is placed, encrusted with dainty diamonds, adding a touch of femininity and charm. The gracefully curved ribbons of the bow enhance its luxurious appeal, while the intricate bail makes sure that this Solitaire Pendant rests on your neckline seamlessly. Designed for versatility, this 2 CT Diamond Necklace is an ideal choice for bridal wear, remarkable celebrations, or even as a refined statement piece for elegant evenings. Plus, it is curated with lab grown diamonds so it offers not only brilliance but also an ethical choice for the modern woman.

Product Information
SKU SHP-PENDANT022510043
Metal Weight 3.80 gm (Approximate)
Total Stone Weight 2.09 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 18 Pieces
Total Weight 2.09 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-17 Pcs
Round-8X8 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Bezel-Setting
Quality Grade EF-VS
View More