2 Carat Vintage Inspired Moissanite Halo Necklace in 14k Gold Plated Silver

0
Regular price $140
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Star Icon

With 18 Inch Chain


Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

This Vintage inspired Moissanite Pendant is all you want to complete your look for a special day. The Pendant features a 7X9 MM Oval Shape Moissanite securely placed in prong setting and encircled by a smaller halo of Moissanite stones and accentuated with a stone studded floral motif. This Vintage Pendant Necklace beholds the shine of D-VS1 Quality Moissanite and dangles in a silver cable chain, which can be adjusted as per style. This Oval Necklace can be a perfect choice of gift for your beloved on their special day. Crafted to be a statement piece, this Cocktail Necklace seamlessly shifts from daytime looks to evening outfits. The combination of natural elements, geometric shapes, and sparkling gemstones elevates this item to a true wearable masterpiece. Unique and striking, this Moissanite Flower Pendant adds a touch of individuality, confidence, and enduring charm to any jewelry collection. Designed to be both unique and everlasting, this Silver Moissanite Necklace makes a striking impression with its creative design and romantic feel. It comes beautifully packaged in a premium box, perfect for safekeeping or as a present. So why delay? Fulfill her wishes and present her with this stunning and timeless jewelry piece today.

Product Information
SKU RCPE082410073-FBA
Weight 3.51 gm (Approximate)
Center Stone Weight 2.17 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 29 Pieces
Total Weight 2.53 Carat (Approximate)
Dimension(approx) Oval-7X9 mm-1 Pcs
Round-1.20X1.20 mm-23 Pcs
Round-1X1 mm-5 Pcs
Color White
Cut Brilliant
Shape Oval, Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More