2 Carat Oval Shaped Ethiopian Opal and Diamond Flower Necklace with Chain

0
Sale price $139 Regular price $198
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold Plated Silver
Star Icon

With 18 Inch Chain


Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Illuminate your bridal ensemble with the glow of this handcrafted Ethiopian Opal Necklace. Designed to capture the essence of elegance and emotion, this Oval Locket Necklace is crafted in 14K yellow gold plated silver, perfect for the bride who seeks meaningful beauty with a timeless twist. At its heart lies a captivating 7X9 MM oval cut Ethiopian Opal, cradled in a secure prong setting. Above the luminous centerpiece rests a finely sculpted floral motif, adorned with round lab grown diamonds. This nature-inspired detail adds a romantic shimmer, enhancing the necklace graceful silhouette. Blending vintage charm with a modern sensibility, this Opal and Diamond Necklace is more than just an accessory, it is a statement of love, light, and individuality. The Flower Pendant is suspended from an elegant, adjustable chain secured by a lobster clasp, offering versatility and comfort whether worn close to the collarbone or slightly lower for a layered look. Lightweight yet striking, it is the perfect finishing touch for your wedding day, bridesmaid gifts, or a meaningful keepsake to mark a special moment. The AAA quality Ethiopian Opal paired with EF-VS quality lab grown diamonds brings an air of refinement that will never go out of style. Presented in a signature jewelry box, this Floral Necklace is ready to be gifted, worn, and treasured, today and for years to come.

Product Information
SKU RCPE062510147-FBA
Weight 3.50 gm (Approximate)
Center Stone Weight 1.90 Carat (Approximate)
ETHIOPIAN OPAL INFORMATION
No.of Stones 1 Pieces
Total Weight 1.90 Carat (Approximate)
Dimension(approx) Oval-7X9 mm-1 Pcs
Color Rainbow
Cut Brilliant
Shape Oval
Setting Type Prong-Setting
Quality Grade AAA
LAB GROWN DIAMOND INFORMATION
No.of Stones 10 Pieces
Total Weight 0.15 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-10 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More