2 Carat Moissanite Double Prong Vintage Engagement Ring

0
Sale price $356 Regular price $409
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

This Moissanite Engagement Ring is a truly special piece, designed to capture hearts with its nature-inspired beauty and brilliant sparkle. At the center is an 8 MM round cut moissanite, set in secure double prong setting as a classic solitaire. Surrounding it are delicate floral engravings along the band, accented with tiny moissanite stones that add an elegant shimmer and a touch of vintage charm. The Solitaire Engagement Ring features beautiful beaded detailing that enhances its graceful design, while a hidden flower motif beneath the center stone holds a sparkling peek-a-boo stone - adding a surprise touch of shine without taking the spotlight from the dazzling solitaire. Crafted for those who love nature and timeless romance, this Vintage Style Ring combines soft floral elements with radiant sparkle. The 2 carat D-VS1 quality moissanite catches the light beautifully, making it a symbol of love, commitment, and cherished memories. Perfect for brides looking for something unique yet classic, this Flower Engagement Ring blends romance, elegance, and a bit of old-world charm. It is a meaningful piece she will treasure forever, a true celebration of love in every detail.

Product Information
SKU SHP-RINGS042014759
Width 6.5 mm
Height 8 mm
Metal Weight 3.82 gm (Approximate)
Center Stone Weight 2.10 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 9 Pieces
Total Weight 2.18 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-8 Pcs
Round-8X8 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Double-Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-engagement-rings